Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2047 bp · TkA03G482030|TK1151|cDNA
AAAATATGTAAGCACAATGATAGGAAGGCGATAGTACAAGTGTTTTTCTGCTATTTTGCATCAAAAACATCAGAAACTTTCTTGAGACACAAGTTCTTGGTAGCAAGAAGCAGAAGACTGAAAATGGGGACAAGGATCTTGAGAAAAATAATTTTGGAAAGGAGACAGAGGAAAATACTAAGGAAGAGCAAAACAAATCCTCACAAGAGAACAAGGGTGAGGTGTCTCCGGATATAAAGCCAGCAGAAACTACACATGAT...
1677 bp · TkA03G482030|TK1151|CDS
ATGGGCAAATCAAGGAAGAAACCCGATTCCGAAGCTGATTCGGATCCTGCGGTTGTAGCTTCACCCGCCGCTCTAATAGCAAATGAGACACAAGTTCTTGGTAGCAAGAAGCAGAAGACTGAAAATGGGGACAAGGATCTTGAGAAAAATAATTTTGGAAAGGAGACAGAGGAAAATACTAAGGAAGAGCAAAACAAATCCTCACAAGAGAACAAGGGTGAGGTGTCTCCGGATATAAAGCCAGCAGAAACTACACATGA...
Protein
Download Protein FASTA558 aa · TkA03G482030|TK1151|PROTEIN
MGKSRKKPDSEADSDPAVVASPAALIANETQVLGSKKQKTENGDKDLEKNNFGKETEENTKEEQNKSSQENKGEVSPDIKPAETTHDENEAKITNDYEAKKGEDKSKEDHQHLETPIESVDVPSDIKSTPTTQDAKKARISNNEEQDGDDDSKKSGTDVEMLDDSSLKKMDQAELSSQPPGSKTVLMDNLSFLIKEEDVRKFFKNVGEIAEIHFEMKEDYFTGHGHVKFMTAEAAQEAVKLSNTSLLDRHVKLNLATKRD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G482030 |
|---|---|
| TK1151 ID | TkA03G482030 |
| OH-1004 ID | LXL04_009911 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 85.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G482030 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:120561231-120568010 (-) | |||||||||
| Description | Similar to Os04g0620700: Nucleolin 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006364 rRNA processing Biological Process GO:0010305 leaf vascular tissue pattern formation Biological Process GO:0010588 cotyledon vascular tissue pattern formation Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0048364 root development Biological Process GO:0048366 leaf development Biological Process GO:0048367 shoot system development Biological Process GO:0080056 petal vascular tissue pattern formation Biological Process GO:0080057 sepal vascular tissue pattern formation Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005739 mitochondrion Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G48920 ath:AT3G18610 dosa:Os04g0620700 dosa:Os08g0192900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF29326RRM_MUD2_C45-66 aaPF29674Kk1D_mid95-147 aaPF00076RRM_1186-250 aaPF13452FAS1_DH_region188-226 aaPF22976RRM_10189-247 aaPF28441RRM_11190-258 aaPF08777RRM_3195-245 aaPF14605Nup35_RRM_2197-239 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G482030 | PF29326 | RRM_MUD2_C | 45 | 66 | 0.043 | 14.6 |
| TkA03G482030 | PF29674 | Kk1D_mid | 95 | 147 | 0.54 | 11.7 |
| TkA03G482030 | PF00076 | RRM_1 | 186 | 250 | 4.5e-36 | 123.3 |
| TkA03G482030 | PF13452 | FAS1_DH_region | 188 | 226 | 0.078 | 13.8 |
| TkA03G482030 | PF22976 | RRM_10 | 189 | 247 | 0.0019 | 19.0 |
| TkA03G482030 | PF28441 | RRM_11 | 190 | 258 | 9.9e-05 | 23.3 |
| TkA03G482030 | PF08777 | RRM_3 | 195 | 245 | 1.3e-05 | 25.9 |
| TkA03G482030 | PF14605 | Nup35_RRM_2 | 197 | 239 | 4.4e-11 | 43.2 |
| TkA03G482030 | PF15513 | DUF4651 | 197 | 216 | 0.0076 | 16.5 |
| TkA03G482030 | PF24475 | RBD_DEAH11 | 217 | 254 | 0.00039 | 21.2 |
| TkA03G482030 | PF26250 | RRM_RdRP1_2 | 222 | 247 | 0.02 | 16.0 |
| TkA03G482030 | PF29326 | RRM_MUD2_C | 223 | 254 | 0.043 | 14.6 |
| TkA03G482030 | PF29674 | Kk1D_mid | 236 | 252 | 0.54 | 11.7 |
| TkA03G482030 | PF22976 | RRM_10 | 272 | 332 | 0.0019 | 19.0 |
| TkA03G482030 | PF00076 | RRM_1 | 276 | 342 | 4.5e-36 | 123.3 |
| TkA03G482030 | PF26250 | RRM_RdRP1_2 | 278 | 330 | 0.02 | 16.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.