TkA03G481370 | RubberDandelionOmics

Gene overview

TkA03G481370

Reference: TK1151 Chr: Chr03 Coordinates: 120385198-120385845 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA03G481370|TK1151|cDNA

ATGGTCATGAAAAACGATACTCCAAAGCCTGCACCGCCGGCCAAGATTCCCGGTGTCGACGAAGTACATTACCGGGGAGTACGAAAGCGGCCGTGGGGCCGTTACGCGGCGGAGATCCGTGACCCTGGAACAAAAACCCGAGTATGGTTAGGTACTTTCGACACAGCGGAGGAAGCAGCTAAAGCATACGACACCGCCGCCATCAATTTCCGAGGATCCAAGGCGAAAATCAACTTTCCTCCATCCATAGACGACGTTTC...

CDS

Download CDS FASTA

648 bp · TkA03G481370|TK1151|CDS

ATGGTCATGAAAAACGATACTCCAAAGCCTGCACCGCCGGCCAAGATTCCCGGTGTCGACGAAGTACATTACCGGGGAGTACGAAAGCGGCCGTGGGGCCGTTACGCGGCGGAGATCCGTGACCCTGGAACAAAAACCCGAGTATGGTTAGGTACTTTCGACACAGCGGAGGAAGCAGCTAAAGCATACGACACCGCCGCCATCAATTTCCGAGGATCCAAGGCGAAAATCAACTTTCCTCCATCCATAGACGACGTTTC...

Protein

Download Protein FASTA

215 aa · TkA03G481370|TK1151|PROTEIN

MVMKNDTPKPAPPAKIPGVDEVHYRGVRKRPWGRYAAEIRDPGTKTRVWLGTFDTAEEAAKAYDTAAINFRGSKAKINFPPSIDDVSGQSPTQSGTVECSTSSPFPIQPPQPLELDLTRRLEVSVAGYQLYRNGGPQTVAVVPHGQPIMLFMDRGYQYLYQYNQMIERDHVNRFSGVLSESDSSSVADCSAGRDTSISRRELNLDLNLAPPAVDV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G481370`
TK1151 ID	TkA03G481370
OH-1004 ID	LXL04_009898
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G481370

Location Chr03:120385198-120385845 (-)

Description Similar to ERF4: Ethylene-responsive transcription factor 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15210`	Acts as a transcriptional repressor.	Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression.2000 · DOI: 10.1105/tpc.12.3.393 Repression domains of class II ERF transcriptional repressors share an essential motif for active repression.2001 · DOI: 10.1105/tpc.010127
`At5g44210`	Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.	No verified direct reference in this release
`At1g53170`	Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009898 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0071456 cellular response to hypoxia Biological Process

KEGG gene cross-reference

ath:AT1G53170

ath:AT3G15210

ath:AT5G44210

nsy:104222902

nta:107778042

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA03G481370 · TK1151

Cytoplasm0.085

Rank 2 · TkA03G481370 · TK1151

Cell membrane0.026

Rank 3 · TkA03G481370 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA03G481370 · TK1151

Plastid0.020

Rank 5 · TkA03G481370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP223-72 aa

PF26003Integrase_N_phage27-60 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G481370	`PF00847`	AP2	23	72	1.7e-15	57.7
TkA03G481370	`PF26003`	Integrase_N_phage	27	60	0.24	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80340`	Arabidopsis thaliana	sp\|O80340\|ERF78_ARATH Ethylene-responsive transcription factor 4	44.300%	Swiss-Prot	Medium
`Q9FE67`	Arabidopsis thaliana	sp\|Q9FE67\|ERF80_ARATH Ethylene-responsive transcription factor 9	90.000%	Swiss-Prot	Low
`Q9MAI5`	Arabidopsis thaliana	sp\|Q9MAI5\|ERF79_ARATH Ethylene-responsive transcription factor 8	64.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card