TkA03G474440 | RubberDandelionOmics

Gene overview

TkA03G474440

Reference: TK1151 Chr: Chr03 Coordinates: 118646144-118647448 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

559 bp · TkA03G474440|TK1151|cDNA

TAAAAACCACACAATTCAAAGCACCACCCTCACCATCGCCAACTCCAACTACAAAATGTCACCGGCGATCGGAACATCAAGCAGGATCCGCCACATTGTTAGAGTCCGACAGATGCTATGTCGTTGGCGCAGAAGAGCCACCTCTTCATCACCATCTTCTCGAAGATTGTTGTCAAGCGATGTGCCGGCGGGACATATCGCGATCTGCGTTGGCAGCAATTGCCGGAGGTTTATCGTGAGAGCTACGTACCTGAACCACC...

CDS

Download CDS FASTA

444 bp · TkA03G474440|TK1151|CDS

ATGTCACCGGCGATCGGAACATCAAGCAGGATCCGCCACATTGTTAGAGTCCGACAGATGCTATGTCGTTGGCGCAGAAGAGCCACCTCTTCATCACCATCTTCTCGAAGATTGTTGTCAAGCGATGTGCCGGCGGGACATATCGCGATCTGCGTTGGCAGCAATTGCCGGAGGTTTATCGTGAGAGCTACGTACCTGAACCACCCCGTGTTCCAGAGGCTTCTAGCGGAAGCTGAAGAAGAATACGGCTTTTATAACAA...

Protein

Download Protein FASTA

147 aa · TkA03G474440|TK1151|PROTEIN

MSPAIGTSSRIRHIVRVRQMLCRWRRRATSSSPSSRRLLSSDVPAGHIAICVGSNCRRFIVRATYLNHPVFQRLLAEAEEEYGFYNKGPLTIPCEESEFEEILRLVSRPELDTGNKSGRFVNIEDLHRFCHVGYVAESKPLLHGSVY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G474440`
TK1151 ID	TkA03G474440
OH-1004 ID	LXL04_009820
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 76.871 / OH-1004 85.606 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G474440

Location Chr03:118646144-118647448 (+)

Description Similar to ARG7: Indole-3-acetic acid-induced protein ARG7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46690`	May play a role in the apical hook development (Ref.7).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009820 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:1900140 regulation of seedling development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G79130

ath:AT2G46690

gmx:100775873

gmx:100817568

gmx:106798973

gmx:113001050

gmx:113001959

gmx:113001961

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.467

Rank 1 · TkA03G474440 · TK1151

Nucleus0.422

Rank 2 · TkA03G474440 · TK1151

Cell membrane0.214

Rank 3 · TkA03G474440 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA03G474440 · TK1151

Plastid0.044

Rank 5 · TkA03G474440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519Auxin_inducible16-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G474440	`PF02519`	Auxin_inducible	16	108	6.5e-29	100.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUZ3`	Arabidopsis thaliana	sp\|Q9ZUZ3\|SAU32_ARATH Auxin-responsive protein SAUR32	52.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card