TkA03G471990 | RubberDandelionOmics

Gene overview

TkA03G471990

Reference: TK1151 Chr: Chr03 Coordinates: 117977804-117980196 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1433 bp · TkA03G471990|TK1151|cDNA

ATGGAAAGATTCAAACAACTTCAACAAGAGAAGAAGGAAAAGGGCCCACCTTTATCAGTGTCCCAAAAACCTAACCCTATCTCTAGTAATAGCAAGTCCTCTTCAGCTGGCAAACTTGCATTTAGTCTTAAACAGAAATCAAAACTTGTGACACCTGCTGTTAAGTTAAGTGAAGAAGATGAAGAAGATGATGAAAGTAATGGATTAAGTGATGTACCAATAAAAAAGCAAAAGTTGGAGCAACCTTATGTCTCTGACCC...

CDS

Download CDS FASTA

1152 bp · TkA03G471990|TK1151|CDS

ATGGAAAGATTCAAACAACTTCAACAAGAGAAGAAGGAAAAGGGCCCACCTTTATCAGTGTCCCAAAAACCTAACCCTATCTCTAGTAATAGCAAGTCCTCTTCAGCTGGCAAACTTGCATTTAGTCTTAAACAGAAATCAAAACTTGTGACACCTGCTGTTAAGTTAAGTGAAGAAGATGAAGAAGATGATGAAAGTAATGGATTAAGTGATGTACCAATAAAAAAGCAAAAGTTGGAGCAACCTTATGTCTCTGACCC...

Protein

Download Protein FASTA

383 aa · TkA03G471990|TK1151|PROTEIN

MERFKQLQQEKKEKGPPLSVSQKPNPISSNSKSSSAGKLAFSLKQKSKLVTPAVKLSEEDEEDDESNGLSDVPIKKQKLEQPYVSDPSLKQVYVTYAAPSDPTIKKVADKLASFVAKNGRQFEHITRQKNPGDSPFKFLFDESCADYKYYEYRLIEEEKALTNSVDSQNATQKSPQKQPINTCQKSHQQQNYQIPASALYDPTDNEYISSSESSAPSGSDPIAMMEFYMKKAAQEERKRQPKYSKDEMPPPASLLGGGKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G471990`
TK1151 ID	TkA03G471990
OH-1004 ID	LXL04_026400
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	36.200
Protein coverage (%)	TK1151 18.016 / OH-1004 18.428 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G471990

Location Chr03:117977804-117980196 (+)

Description Similar to GDP1: G-patch domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52120`	SURP and G-patch domain-containing protein 1-like protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026400 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009637 response to blue light Biological Process

GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0031397 negative regulation of protein ubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0070198 protein localization to chromosome, telomeric region Biological Process

GO:0090069 regulation of ribosome biogenesis Biological Process

KEGG gene cross-reference

ath:AT1G63980

hsa:54984

rno:305963

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.893

Rank 1 · TkA03G471990 · TK1151

Cytoplasm0.257

Rank 2 · TkA03G471990 · TK1151

Cell membrane0.025

Rank 3 · TkA03G471990 · TK1151

Mitochondrion0.025

Rank 4 · TkA03G471990 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA03G471990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01805Surp99-163 aa

PF27438PXO2_28_C128-203 aa

PF12656G-patch_2294-345 aa

PF01585G-patch301-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G471990	`PF01805`	Surp	99	163	9.6e-16	57.9
TkA03G471990	`PF27438`	PXO2_28_C	128	203	0.049	14.3
TkA03G471990	`PF12656`	G-patch_2	294	345	3.9e-05	24.3
TkA03G471990	`PF01585`	G-patch	301	344	2.7e-15	56.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94C11`	Arabidopsis thaliana	sp\|Q94C11\|SUGP1_ARATH SURP and G-patch domain-containing protein 1-like protein	55.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card