TkA03G471040 | RubberDandelionOmics

Gene overview

TkA03G471040

Reference: TK1151 Chr: Chr03 Coordinates: 117728574-117729794 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

696 bp · TkA03G471040|TK1151|cDNA

ATGGGTGCCGTGAAGGCTGATGGAAGCATGAAACCAAGATCGGAAAAGGTGGGTTTTAATACAGAAAGACCGTTAGTTTATGATCTTGATGAGATTGCAGAGGCTACAAACAATTTTGATGACTCTAGGAAGATTGGAGAGGGTGGATATGGGAGTATGTACTTTGGTATATTAGGAGGAAAGGAGGTAGCAGTTAAGAAAATGAGATCGAATAAGTCGAAAGAGTTTCTTGCAGAACTTAAAGTGTTGTGTAGGATTCA...

CDS

Download CDS FASTA

696 bp · TkA03G471040|TK1151|CDS

ATGGGTGCCGTGAAGGCTGATGGAAGCATGAAACCAAGATCGGAAAAGGTGGGTTTTAATACAGAAAGACCGTTAGTTTATGATCTTGATGAGATTGCAGAGGCTACAAACAATTTTGATGACTCTAGGAAGATTGGAGAGGGTGGATATGGGAGTATGTACTTTGGTATATTAGGAGGAAAGGAGGTAGCAGTTAAGAAAATGAGATCGAATAAGTCGAAAGAGTTTCTTGCAGAACTTAAAGTGTTGTGTAGGATTCA...

Protein

Download Protein FASTA

231 aa · TkA03G471040|TK1151|PROTEIN

MGAVKADGSMKPRSEKVGFNTERPLVYDLDEIAEATNNFDDSRKIGEGGYGSMYFGILGGKEVAVKKMRSNKSKEFLAELKVLCRIHHINVVELLGFASGDDHLYLVYEFVSNGSLSEHLHDPLLKGHQPLSWTARAQIALDAAKGIKYIHDHTKERYVHRDIKTTNILLDNCLRAKVADFGLAKLVGRTNDDDFIATCLVGTPGYLPPERVSSKKQTQVRTNFDFASIQC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G471040`
TK1151 ID	TkA03G471040
OH-1004 ID	LXL04_025827
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.800
Protein coverage (%)	TK1151 90.043 / OH-1004 33.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G471040

Location Chr03:117728574-117729794 (+)

Description Similar to LYK3: LysM domain receptor-like kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51940`	Putative Lysin motif (LysM) receptor kinase that may recognize microbe-derived N-acetylglucosamine (NAG)-containing ligands.	No verified direct reference in this release
`At3g21630`	Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity toward both biotic and abiotic stresses (e.g. tolerance to salinity, heavy-metal stresses, and Botrytis cinerea infection).	CERK1, a LysM receptor kinase, is essential for chitin elicitor signaling in Arabidopsis.2007 · DOI: 10.1073/pnas.0705147104 AvrPtoB targets the LysM receptor kinase CERK1 to promote bacterial virulence on plants.2009 · DOI: 10.1016/j.cub.2009.01.054 The lysin motif receptor-like kinase (LysM-RLK) CERK1 is a major chitin-binding protein in Arabidopsis thaliana and subject to chitin-induced phosphorylation.2010 · DOI: 10.1074/jbc.m110.116657 Arabidopsis lysin-motif proteins LYM1 LYM3 CERK1 mediate bacterial peptidoglycan sensing and immunity to bacterial infection.2011 · DOI: 10.1073/pnas.1112862108 The LysM receptor-like kinase LysM RLK1 is required to activate defense and abiotic-stress responses induced by overexpression of fungal chitinases in Arabidopsis plants.2012 · DOI: 10.1093/mp/sss021 Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants.2012 · DOI: 10.1093/pcp/pcs113 Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27.2014 · DOI: 10.1111/tpj.12535

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0511000`	LysM domain receptor-like kinase 10.	No verified direct reference in this release
`Os08g0538300`	Lysin motif (LysM) receptor kinase required as a cell surface receptor for chitin elicitor (chitooligosaccharides) signaling leading to innate immunity in response to biotic stresses.	Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice.2010 · DOI: 10.1111/j.1365-313x.2010.04324.x Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants.2012 · DOI: 10.1093/pcp/pcs113 A receptor-like cytoplasmic kinase targeted by a plant pathogen effector is directly phosphorylated by the chitin receptor and mediates rice immunity.2013 · DOI: 10.1016/j.chom.2013.02.007 Targeted gene disruption of OsCERK1 reveals its indispensable role in chitin perception and involvement in the peptidoglycan response and immunity in rice.2014 · DOI: 10.1094/mpmi-03-14-0068-r OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025827 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002752 cell surface pattern recognition receptor signaling pathway Biological Process

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009877 nodulation Biological Process

GO:0010200 response to chitin Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0032491 detection of molecule of fungal origin Biological Process

KEGG gene cross-reference

ath:AT1G51940

ath:AT3G21630

dosa:Os08g0538300

dosa:Os09g0511000

osa:9270778

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.538

Rank 1 · TkA03G471040 · TK1151

Cytoplasm0.403

Rank 2 · TkA03G471040 · TK1151

Nucleus0.255

Rank 3 · TkA03G471040 · TK1151

Golgi apparatus0.043

Rank 4 · TkA03G471040 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA03G471040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase40-218 aa

PF07714PK_Tyr_Ser-Thr42-218 aa

PF01636APH55-183 aa

PF13101DUF394559-82 aa

PF03109ABC160-88 aa

PF14531Kinase-like125-217 aa

PF03109ABC1150-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G471040	`PF00069`	Pkinase	40	218	1.8e-36	126.6
TkA03G471040	`PF07714`	PK_Tyr_Ser-Thr	42	218	7.6e-33	114.6
TkA03G471040	`PF01636`	APH	55	183	0.03	14.8
TkA03G471040	`PF13101`	DUF3945	59	82	0.16	12.4
TkA03G471040	`PF03109`	ABC1	60	88	0.088	12.7
TkA03G471040	`PF14531`	Kinase-like	125	217	0.081	12.9
TkA03G471040	`PF03109`	ABC1	150	195	0.088	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IB81`	Arabidopsis thaliana	sp\|F4IB81\|LYK3_ARATH LysM domain receptor-like kinase 3	54.500%	Swiss-Prot	High
`A8R7E6`	Arabidopsis thaliana	sp\|A8R7E6\|CERK1_ARATH Chitin elicitor receptor kinase 1	49.000%	Swiss-Prot	Medium
`D7UPN3`	Oryza sativa subsp. japonica	sp\|D7UPN3\|RLK10_ORYSJ LysM domain receptor-like kinase 10	49.200%	Swiss-Prot	Medium
`A0A0P0XII1`	Oryza sativa subsp. japonica	sp\|A0A0P0XII1\|CERK1_ORYSJ Chitin elicitor receptor kinase 1	48.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card