TkA03G469710 | RubberDandelionOmics

Gene overview

TkA03G469710

Reference: TK1151 Chr: Chr03 Coordinates: 117386151-117387178 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · TkA03G469710|TK1151|cDNA

ATGGTGAGGGCACCTTTTTTTGACAAAAATGGAATGAAAAAAGGTGCTTGGAGTGATGAAGAAGATGGCAAGCTGAAAGCCTATATAGAGAAAAACGGCCATAGGAACTGGCGTAAACTTCCCAAGTTAGCCGGGTTATCAAGATGTGGAAAGAGTTGCAGACTCAGATGGGTGAATTATCTTCGTCCGCAAGTGAAGCGTGGAAACTACACAAGTGAAGAAGAAGATCTCATAATTAACTTACATAGAAATCATGGCAG...

CDS

Download CDS FASTA

645 bp · TkA03G469710|TK1151|CDS

ATGGTGAGGGCACCTTTTTTTGACAAAAATGGAATGAAAAAAGGTGCTTGGAGTGATGAAGAAGATGGCAAGCTGAAAGCCTATATAGAGAAAAACGGCCATAGGAACTGGCGTAAACTTCCCAAGTTAGCCGGGTTATCAAGATGTGGAAAGAGTTGCAGACTCAGATGGGTGAATTATCTTCGTCCGCAAGTGAAGCGTGGAAACTACACAAGTGAAGAAGAAGATCTCATAATTAACTTACATAGAAATCATGGCAG...

Protein

Download Protein FASTA

214 aa · TkA03G469710|TK1151|PROTEIN

MVRAPFFDKNGMKKGAWSDEEDGKLKAYIEKNGHRNWRKLPKLAGLSRCGKSCRLRWVNYLRPQVKRGNYTSEEEDLIINLHRNHGSRWSMIAAKLPGRSDNEIKNHWHTHLNEKTEVDQMVLADVCSKSSSTNNKQTSLKAYNGAYYMASNWSLLSNNESFEDFWTKPFFPDSSSDEYLAVSTNLVEYVSLSGDHDSFMVDSYLWSVMDLYGW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G469710`
TK1151 ID	TkA03G469710
OH-1004 ID	LXL04_012163
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.100
Protein coverage (%)	TK1151 54.206 / OH-1004 56.039 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G469710

Location Chr03:117386151-117387178 (-)

Description Similar to MYB4: Transcription factor MYB4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16490`	Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1.	MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321
`At3g12820`	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression.	No verified direct reference in this release
`At3g23250`	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance.	A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance.2006 · DOI: 10.1074/jbc.m605895200 Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana.2009 · DOI: 10.1016/s1673-8527(09)60003-5
`At1g79180`	Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1.	MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0517100`	Transcriptional activator involved in cold stress response.	Overexpression of the rice Osmyb4 gene increases chilling and freezing tolerance of Arabidopsis thaliana plants.2004 · DOI: 10.1046/j.1365-313x.2003.01938.x Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.2010 · DOI: 10.1111/j.1365-3040.2010.02221.x The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.2012 · DOI: 10.1007/s13353-011-0081-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012163 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT2G31180

ath:AT3G23250

ath:AT4G21440

ath:AT4G28110

dosa:Os04g0517100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.947

Rank 1 · TkA03G469710 · TK1151

Cytoplasm0.139

Rank 2 · TkA03G469710 · TK1151

Cell membrane0.023

Rank 3 · TkA03G469710 · TK1151

Mitochondrion0.012

Rank 4 · TkA03G469710 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA03G469710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_712-25 aa

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-75 aa

PF15963Myb_DNA-bind_766-117 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_671-116 aa

PF04177TAP42133-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G469710	`PF15963`	Myb_DNA-bind_7	12	25	0.009	16.5
TkA03G469710	`PF00249`	Myb_DNA-binding	14	61	4.8e-34	116.9
TkA03G469710	`PF13921`	Myb_DNA-bind_6	17	75	1.9e-20	73.5
TkA03G469710	`PF15963`	Myb_DNA-bind_7	66	117	0.009	16.5
TkA03G469710	`PF00249`	Myb_DNA-binding	67	112	4.8e-34	116.9
TkA03G469710	`PF13921`	Myb_DNA-bind_6	71	116	1.9e-20	73.5
TkA03G469710	`PF04177`	TAP42	133	167	0.14	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA47`	Arabidopsis thaliana	sp\|Q9SA47\|MYB58_ARATH Transcription factor MYB58	59.100%	Swiss-Prot	Medium
`Q9LTV4`	Arabidopsis thaliana	sp\|Q9LTV4\|MYB10_ARATH Transcription factor MYB10	59.400%	Swiss-Prot	Medium
`Q9LTC4`	Arabidopsis thaliana	sp\|Q9LTC4\|MYB15_ARATH Transcription factor MYB15	50.600%	Swiss-Prot	High
`Q6R0A6`	Arabidopsis thaliana	sp\|Q6R0A6\|MYB63_ARATH Transcription factor MYB63	66.400%	Swiss-Prot	Medium
`Q7XBH4`	Oryza sativa subsp. japonica	sp\|Q7XBH4\|MYB4_ORYSJ Transcription factor MYB4	64.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card