TkA03G467470 | RubberDandelionOmics

Gene overview

TkA03G467470

Reference: TK1151 Chr: Chr03 Coordinates: 116723490-116727018 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · TkA03G467470|TK1151|cDNA

ATGACGTTGATTAAATCTGTTCTTGGATCGGTTGGTACATATTTTATGTCAGTTTTTTCGGTTCCGGTTACGATTTTAAAAAACCTTAAATCTCTTCGAGCTCGGTTCTTTTTTTTTTTTGGGGGGGGTGAAAAACGCATGCACTGGATGAGATGGGATCGGGTGCTGACTAGTGGGGAGGAAGGTGGCCTTGGTATTGGTAGTTTGTTTTCGTTTAATCGAGCTATGTTGTTCAAGTGGTGGTGGAGGTTTTCTCAAGC...

CDS

Download CDS FASTA

816 bp · TkA03G467470|TK1151|CDS

ATGACGTTGATTAAATCTGTTCTTGGATCGGTTGGTACATATTTTATGTCAGTTTTTTCGGTTCCGGTTACGATTTTAAAAAACCTTAAATCTCTTCGAGCTCGGTTCTTTTTTTTTTTTGGGGGGGGTGAAAAACGCATGCACTGGATGAGATGGGATCGGGTGCTGACTAGTGGGGAGGAAGGTGGCCTTGGTATTGGTAGTTTGTTTTCGTTTAATCGAGCTATGTTGTTCAAGTGGTGGTGGAGGTTTTCTCAAGC...

Protein

Download Protein FASTA

271 aa · TkA03G467470|TK1151|PROTEIN

MTLIKSVLGSVGTYFMSVFSVPVTILKNLKSLRARFFFFFGGGEKRMHWMRWDRVLTSGEEGGLGIGSLFSFNRAMLFKWWWRFSQASESLWVKVVKAIYGEDGGCDSEHHLGSRGPWSGIVKVIRQLRERLSTRDILVESIMCPICTIAVETIDHLLVGRSQLVDVWGRLAIWWGVDCPVLLTVDSLVEWSGLINVNGAQKQAFYAVVVTALWILWNFRNTTVFGSCPKKSSIFDEVVHRSYFWISNRCNQTSISWGSW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G467470`
TK1151 ID	TkA03G467470
OH-1004 ID	LXL04_027391
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.800
Protein coverage (%)	TK1151 53.506 / OH-1004 26.789 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G467470`
Location	Chr03:116723490-116727018 (+)
Description	Similar to CEP14: Precursor of CEP14
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027391` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006970 response to osmotic stress Biological Process GO:0006995 cellular response to nitrogen starvation Biological Process GO:0010037 response to carbon dioxide Biological Process GO:1902025 nitrate import Biological Process GO:2000280 regulation of root development Biological Process GO:0048046 apoplast Cellular Component GO:0005179 hormone activity Molecular Function
KEGG gene cross-reference	ath:AT1G29290 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.383

Rank 1 · TkA03G467470 · TK1151

Cell membrane0.218

Rank 2 · TkA03G467470 · TK1151

Nucleus0.172

Rank 3 · TkA03G467470 · TK1151

Golgi apparatus0.149

Rank 4 · TkA03G467470 · TK1151

Endoplasmic reticulum0.106

Rank 5 · TkA03G467470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT128-168 aa

PF13966zf-RVT246-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G467470	`PF13966`	zf-RVT	128	168	0.008	17.5
TkA03G467470	`PF13966`	zf-RVT	246	248	0.008	17.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card