TkA03G467030 | RubberDandelionOmics

Gene overview

TkA03G467030

Reference: TK1151 Chr: Chr03 Coordinates: 116621079-116622088 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · TkA03G467030|TK1151|cDNA

ATGGGGCTGTTTGATTTTGGGAAGACTCAGTCTAGTCCGCACCACATCGGACTCGGTCTTCAGTCTGGGTGTTTGGTAATTGAATTTCACGTCGGACTCGGTCCGTCCCTCGGACTCACACATCAGACCGAGTCCAGAGAAAAATATCACAGACTCGTGCTTTCCCCCTTTGATACCCTTTTTGCCCTACACAAAAAAACCATCGCCTCCTCCACTCTCCAAATCGGCGACCCTGCAACCCGGCATCTCCCGCGTCTCCC...

CDS

Download CDS FASTA

768 bp · TkA03G467030|TK1151|CDS

ATGGGGCTGTTTGATTTTGGGAAGACTCAGTCTAGTCCGCACCACATCGGACTCGGTCTTCAGTCTGGGTGTTTGGTAATTGAATTTCACGTCGGACTCGGTCCGTCCCTCGGACTCACACATCAGACCGAGTCCAGAGAAAAATATCACAGACTCGTGCTTTCCCCCTTTGATACCCTTTTTGCCCTACACAAAAAAACCATCGCCTCCTCCACTCTCCAAATCGGCGACCCTGCAACCCGGCATCTCCCGCGTCTCCC...

Protein

Download Protein FASTA

255 aa · TkA03G467030|TK1151|PROTEIN

MGLFDFGKTQSSPHHIGLGLQSGCLVIEFHVGLGPSLGLTHQTESREKYHRLVLSPFDTLFALHKKTIASSTLQIGDPATRHLPRLPPISGVSLPSPASASHLRHLQMLCSSYMLLISDIVLHTCYFIGKYGPRRETTKDVILHGYKIKAKTVVFVNAFAIGRDPGSWENPEKFSPERFLGNNIDFRGNDFELIPFGAGRRICPGISMGVATVDLLLANLLYLFDWGLPNGMKKEEIDFDVMPGITMHKRNDLFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G467030`
TK1151 ID	TkA03G467030
OH-1004 ID	LXL04_008800
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.100
Protein coverage (%)	TK1151 47.451 / OH-1004 24.297 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G467030

Location Chr03:116621079-116622088 (-)

Description Similar to CYP83B1: Cytochrome P450 83B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45570`	Cytochrome P450 76C2.	No verified direct reference in this release
`At2g02580`	Cytochrome P450 71B9.	No verified direct reference in this release
`At2g45550`	Cytochrome P450 76C4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008800 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009625 response to insect Biological Process

GO:0009641 shade avoidance Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0010114 response to red light Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048830 adventitious root development Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ag:AXB38860

ag:AXB38861

ag:AXB38863

ath:AT4G31500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.425

Rank 1 · TkA03G467030 · TK1151

Nucleus0.214

Rank 2 · TkA03G467030 · TK1151

Endoplasmic reticulum0.157

Rank 3 · TkA03G467030 · TK1151

Peroxisome0.114

Rank 4 · TkA03G467030 · TK1151

Mitochondrion0.087

Rank 5 · TkA03G467030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p450134-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G467030	`PF00067`	p450	134	251	1.8e-30	106.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64637`	Arabidopsis thaliana	sp\|O64637\|C76C2_ARATH Cytochrome P450 76C2	57.100%	Swiss-Prot	Low
`O64718`	Arabidopsis thaliana	sp\|O64718\|C71B9_ARATH Cytochrome P450 71B9	52.900%	Swiss-Prot	Low
`O64635`	Arabidopsis thaliana	sp\|O64635\|C76C4_ARATH Cytochrome P450 76C4	54.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card