TkA03G466790 | RubberDandelionOmics

Gene overview

TkA03G466790

Reference: TK1151 Chr: Chr03 Coordinates: 116558878-116561051 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · TkA03G466790|TK1151|cDNA

ATGAATGTCGTTGTTTTGGTTTCTTCAGTTTTTTTTACTTTTTTTTGCAGGTTTTCCGTCCGACCCGTGGATTTGAAGCGACATCATCAGCCTTTGGTTTCTGAATATCGCGATCGATTCGAAAACCCGTGGATCTATATCGACTCTATAAGGTTAGTTGCAATTCTGATGTTTGACTGTTACCTTGACAAAATTGGGAAACCGTCTTTGGATATAACATTTGAACATGGACCATTGACTGCTTATGAGTATGCCAGCTA...

CDS

Download CDS FASTA

744 bp · TkA03G466790|TK1151|CDS

ATGAATGTCGTTGTTTTGGTTTCTTCAGTTTTTTTTACTTTTTTTTGCAGGTTTTCCGTCCGACCCGTGGATTTGAAGCGACATCATCAGCCTTTGGTTTCTGAATATCGCGATCGATTCGAAAACCCGTGGATCTATATCGACTCTATAAGGTTAGTTGCAATTCTGATGTTTGACTGTTACCTTGACAAAATTGGGAAACCGTCTTTGGATATAACATTTGAACATGGACCATTGACTGCTTATGAGTATGCCAGCTA...

Protein

Download Protein FASTA

247 aa · TkA03G466790|TK1151|PROTEIN

MNVVVLVSSVFFTFFCRFSVRPVDLKRHHQPLVSEYRDRFENPWIYIDSIRLVAILMFDCYLDKIGKPSLDITFEHGPLTAYEYASYNPIAYDLANHFCEWAANYHTDTPHVMDYNIIHAYPRFLIESYESRAEHGGGFPCAFIGFMVEPVIEHRANGSSNEANGVEPFEMILNPTTEDQAIDRAHRIGHTGPVSVLRLTVKNTVEDRILALQQKKREMVSSAFGEDETGSSQTRLTVDDLKYLFQA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G466790`
TK1151 ID	TkA03G466790
OH-1004 ID	LXL04_010186
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.600
Protein coverage (%)	TK1151 31.984 / OH-1004 6.684 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G466790

Location Chr03:116558878-116561051 (-)

Description Similar to CHR28: Helicase-like transcription factor CHR28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50410`	Probable helicase-like transcription factor involved in transcriptional gene silencing.	SUVR2 is involved in transcriptional gene silencing by associating with SNF2-related chromatin-remodeling proteins in Arabidopsis.2014 · DOI: 10.1038/cr.2014.156 SNF2 chromatin remodeler-family proteins FRG1 and -2 are required for RNA-directed DNA methylation.2014 · DOI: 10.1073/pnas.1420515111
`At3g20010`	Probable helicase-like transcription factor involved in transcriptional gene silencing.	SUVR2 is involved in transcriptional gene silencing by associating with SNF2-related chromatin-remodeling proteins in Arabidopsis.2014 · DOI: 10.1038/cr.2014.156 SNF2 chromatin remodeler-family proteins FRG1 and -2 are required for RNA-directed DNA methylation.2014 · DOI: 10.1073/pnas.1420515111
`At1g71697`	Involved in phospholipid biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010186 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G50410

ath:AT3G20010

ath:AT5G22750

ath:AT5G43530

spo:2540464

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.385

Rank 1 · TkA03G466790 · TK1151

Nucleus0.355

Rank 2 · TkA03G466790 · TK1151

Mitochondrion0.142

Rank 3 · TkA03G466790 · TK1151

Endoplasmic reticulum0.096

Rank 4 · TkA03G466790 · TK1151

Cell membrane0.088

Rank 5 · TkA03G466790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01633Choline_kinase82-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G466790	`PF01633`	Choline_kinase	82	118	3.3e-10	40.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BR5`	Arabidopsis thaliana	sp\|Q94BR5\|CHR28_ARATH Helicase-like transcription factor CHR28	76.600%	Swiss-Prot	Low
`Q9LHE4`	Arabidopsis thaliana	sp\|Q9LHE4\|CHR27_ARATH Helicase-like transcription factor CHR27	72.700%	Swiss-Prot	Low
`Q9M9H6`	Arabidopsis thaliana	sp\|Q9M9H6\|CK1_ARATH Probable choline kinase 1	54.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card