RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G465510
Reference: TK1151 Chr: Chr03 Coordinates: 116168667-116169206 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

540 bp · TkA03G465510|TK1151|cDNA

ATGGCTTCTATTTCTTCAAACACAAAACCCCATAGCCATGTCAGATCCATCAGTTTACCATCAACACTAGACCATCAATCCCAATTCAACGAGTTCTACAGATGTCAAGCTTCTCAAGAAACCACCACATCATCATCATCATCATCGATAGGCGATAAACTAAATCATCTGAATGATATGTATGAATCTATCCAGCCATTCCTTTCATTGCCATCAACTAAGCAATCTTTATCCCAAGGTTGCAACAAAGATCAACTGAA...

CDS

Download CDS FASTA

540 bp · TkA03G465510|TK1151|CDS

ATGGCTTCTATTTCTTCAAACACAAAACCCCATAGCCATGTCAGATCCATCAGTTTACCATCAACACTAGACCATCAATCCCAATTCAACGAGTTCTACAGATGTCAAGCTTCTCAAGAAACCACCACATCATCATCATCATCATCGATAGGCGATAAACTAAATCATCTGAATGATATGTATGAATCTATCCAGCCATTCCTTTCATTGCCATCAACTAAGCAATCTTTATCCCAAGGTTGCAACAAAGATCAACTGAA...

Protein

Download Protein FASTA

179 aa · TkA03G465510|TK1151|PROTEIN

MASISSNTKPHSHVRSISLPSTLDHQSQFNEFYRCQASQETTTSSSSSSIGDKLNHLNDMYESIQPFLSLPSTKQSLSQGCNKDQLNKFLDELVELLDLCSTTKDSLSISMDYAKELQSVIRRKRGDNHGLISSVEGYLSQRRKMKKVICKTMSGLQKHMSSSVKEDQRLNQTLKCWRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G465510
TK1151 IDTkA03G465510
OH-1004 IDLXL04_009705
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)97.100
Protein coverage (%)TK1151 97.765 / OH-1004 23.522
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G465510
LocationChr03:116168667-116169206 (-)
DescriptionSimilar to DGK1: Diacylglycerol kinase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009705 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway Biological Process
GO:0009409 response to cold Biological Process
GO:0009611 response to wounding Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0046486 glycerolipid metabolic process Biological Process
GO:0048364 root development Biological Process
GO:0048366 leaf development Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0016020 membrane Cellular Component
GO:0004143 ATP-dependent diacylglycerol kinase activity Molecular Function
KEGG gene cross-reference
ath:AT5G07920
ath:AT5G63770
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.609
Rank 1 · TkA03G465510 · TK1151
Nucleus0.452
Rank 2 · TkA03G465510 · TK1151
Cell membrane0.132
Rank 3 · TkA03G465510 · TK1151
Endoplasmic reticulum0.050
Rank 4 · TkA03G465510 · TK1151
Mitochondrion0.020
Rank 5 · TkA03G465510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03087BPS18-45 aa
PF16123HAGH_C14-41 aa
PF03087BPS153-168 aa
PF16809NleF_casp_inhib57-107 aa
PF23172bHLH_NCOA78-121 aa
PF12325TMF_TATA_bd84-102 aa
PF12325TMF_TATA_bd107-173 aa
PF21276ZNF512_C2HC148-162 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G465510PF03087BPS18451.5e-2797.6
TkA03G465510PF16123HAGH_C14410.09113.9
TkA03G465510PF03087BPS1531681.5e-2797.6
TkA03G465510PF16809NleF_casp_inhib571070.01416.2
TkA03G465510PF23172bHLH_NCOA781210.04215.1
TkA03G465510PF12325TMF_TATA_bd841020.1413.0
TkA03G465510PF12325TMF_TATA_bd1071730.1413.0
TkA03G465510PF21276ZNF512_C2HC1481620.0813.4
TkA03G465510PF23172bHLH_NCOA1531660.04215.1
TkA03G465510PF16123HAGH_C1571710.09113.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser