TkA03G463130 | RubberDandelionOmics

Gene overview

TkA03G463130

Reference: TK1151 Chr: Chr03 Coordinates: 115598571-115600288 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1101 bp · TkA03G463130|TK1151|cDNA

ATGTACTTGGGATTTTTCTATCTTCTAGTGGGAACTTTTTTTGCGGTTTCACAAGCTTCAACTACGCCCAGCTTCCCTGCTAATATCACTACGCCCGCCATTTTCATATTTGGTGATTCAACTGCTGATGTTGGAACGAACTCTTTTTTGCCAAAAACCAAAATAAAAGCCAATTTTCCTCACAATGGGATTGATTTTCCCAATTCTCGACCCACAGGACGCTTTAGCAATGGCTTCAACAGTGCTGATTATTTGTCAAA...

CDS

Download CDS FASTA

1101 bp · TkA03G463130|TK1151|CDS

ATGTACTTGGGATTTTTCTATCTTCTAGTGGGAACTTTTTTTGCGGTTTCACAAGCTTCAACTACGCCCAGCTTCCCTGCTAATATCACTACGCCCGCCATTTTCATATTTGGTGATTCAACTGCTGATGTTGGAACGAACTCTTTTTTGCCAAAAACCAAAATAAAAGCCAATTTTCCTCACAATGGGATTGATTTTCCCAATTCTCGACCCACAGGACGCTTTAGCAATGGCTTCAACAGTGCTGATTATTTGTCAAA...

Protein

Download Protein FASTA

366 aa · TkA03G463130|TK1151|PROTEIN

MYLGFFYLLVGTFFAVSQASTTPSFPANITTPAIFIFGDSTADVGTNSFLPKTKIKANFPHNGIDFPNSRPTGRFSNGFNSADYLSKLMGQKRSPQPFLFLLKAGLRKRMFRGVNFASGASGLLDGTGKHLQNVVSMSEQIKQFKTVHGNLTLVKGRGATKNIIAKSVFAISVGSNDIFGYFEKQSTVDPAIFIKSLMAAYECHIEESLKSLYNLGARKFGIISVPPVGCCPSQRILNVTGGCFEIENTFARAFHSSLDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G463130`
TK1151 ID	TkA03G463130
OH-1004 ID	LXL04_009693
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 80.874 / OH-1004 42.606 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G463130

Location Chr03:115598571-115600288 (-)

Description Similar to At1g74460: GDSL esterase/lipase At1g74460

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55050`	GDSL esterase/lipase At5g55050.	No verified direct reference in this release
`At1g71250`	GDSL esterase/lipase At1g71250.	No verified direct reference in this release
`At2g23540`	GDSL esterase/lipase At2g23540.	No verified direct reference in this release
`At5g15720`	GDSL esterase/lipase 7.	No verified direct reference in this release
`At5g18430`	GDSL esterase/lipase At5g18430.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009693 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G74460

ath:AT3G50400

ath:AT5G55050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.558

Rank 1 · TkA03G463130 · TK1151

Endoplasmic reticulum0.103

Rank 2 · TkA03G463130 · TK1151

Cell membrane0.097

Rank 3 · TkA03G463130 · TK1151

Lysosome / Vacuole0.091

Rank 4 · TkA03G463130 · TK1151

Cytoplasm0.088

Rank 5 · TkA03G463130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL34-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G463130	`PF00657`	Lipase_GDSL	34	344	1.9e-26	94.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIA1`	Arabidopsis thaliana	sp\|Q9FIA1\|GDL87_ARATH GDSL esterase/lipase At5g55050	36.500%	Swiss-Prot	Medium
`Q9FVV1`	Arabidopsis thaliana	sp\|Q9FVV1\|GDL28_ARATH GDSL esterase/lipase At1g71250	35.600%	Swiss-Prot	Medium
`O80470`	Arabidopsis thaliana	sp\|O80470\|GDL38_ARATH GDSL esterase/lipase At2g23540	35.800%	Swiss-Prot	Medium
`Q8LFJ9`	Arabidopsis thaliana	sp\|Q8LFJ9\|GLIP7_ARATH GDSL esterase/lipase 7	34.500%	Swiss-Prot	Medium
`Q5PNZ0`	Arabidopsis thaliana	sp\|Q5PNZ0\|GDL77_ARATH GDSL esterase/lipase At5g18430	31.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card