Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1998 bp · TkA03G461620|TK1151|cDNA
ATATTTTCTTAATATTGAAACTAAAGACAGATAAAAGCTTCATAAAACGATCTGATTTGTGAACTTTTGGGACTGGCTTGTAAATTTGTACACACAAATCACGCAGCAGAAGGGTCTGGCCGGGAAATCACACAGGCATATCGGAGGGATGGCCAGCAAATCACGCACCATAAAGGCTACTGTCGGTGGCTTCCATTAACACTCCTATCAATTTCGATAGTTTTCTCCTCAGATTCAACAACTTCCGTCATTTAGACTCA...
1512 bp · TkA03G461620|TK1151|CDS
ATGGACAACGACGCTCACCGTTCCGTATCTTTACGGGCAAGCCGTAGGCCTGATCGTTTAAATAATAACTTCGAGATTAAAGATGGAGGTGATGGTTTCTTTGATTCAGACAAATCATCATCAGACCAACCAATCAAACTCATCTGGAAAAGGGGATTTGTTCGTTTGCTTTTAGTTGGTGGTATTCTATGGATGCTGCTCATTCTAGCCGTACTGTTATTTCATATATGGACATGCCAATCTTCTCTTGTTTTCCTTTC...
Protein
Download Protein FASTA503 aa · TkA03G461620|TK1151|PROTEIN
MDNDAHRSVSLRASRRPDRLNNNFEIKDGGDGFFDSDKSSSDQPIKLIWKRGFVRLLLVGGILWMLLILAVLLFHIWTCQSSLVFLSAICNKDSTVFQMLHTMGLVTPPHRCSIPLASDPEKIVIPEKKTPSNFVQSLSYFEEDDTNINTNGSESSPLFGGHQSWKQREESFNLKSSMKVHCGFMKNGGAEMSDKDMEYVKKCKFVVASGIFDGYDTPHQPSNVSPRSKKLFCFLMVVDEVSLNFINQNVSVKEDKIGGQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G461620 |
|---|---|
| TK1151 ID | TkA03G461620 |
| OH-1004 ID | LXL04_009676 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G461620 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:115275255-115278397 (-) | |||||||||
| Description | Protein of unknown function | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006629 lipid metabolic process Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009860 pollen tube growth Biological Process GO:0009992 intracellular water homeostasis Biological Process GO:0010118 stomatal movement Biological Process GO:0010246 rhamnogalacturonan I biosynthetic process Biological Process GO:0045491 xylan metabolic process Biological Process GO:0048358 mucilage pectin biosynthetic process Biological Process GO:0080001 mucilage extrusion from seed coat Biological Process GO:1902456 regulation of stomatal opening Biological Process GO:0000139 Golgi membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G28240 ath:AT5G46220 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04765TOD1_MUCI70138-447 aaPF04840Vps16_C277-343 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G461620 | PF04765 | TOD1_MUCI70 | 138 | 447 | 3e-130 | 434.8 |
| TkA03G461620 | PF04840 | Vps16_C | 277 | 343 | 0.39 | 10.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.