Gene Card
Gene overview
cDNA / CDS / Protein Sequences
6148 bp · TkA03G459980|TK1151|cDNA
GGAAAATTTTCTTTCTCTTGAATTTACTCCCTCCATGTACAAATTTCTGTATATACACTTCTTCTACACATTCGCTTTCAGCCGATCGGTTTGAATTGAATTAAGACACATTTATATTTAATTTATCAGTTTCGGTTCTCAATACTTCCCCTCGTTTTTGTTAGATTTTGGGTTGATTTGGGTTCCCTTTTTTGATACATCGGGTGATATTCTGTGTGATTTGTGAACGACGATGTTAAGGGTTCAGTGTTTCTTCGATC...
2673 bp · TkA03G459980|TK1151|CDS
ATGATTGACAGTCTAATACTGATTGATCCTCTCGCGAGTTTAGCTGCTGTGGAGGACTTTTTATGGCCACGCGTGCAGCGAAGCGAGGGGAGTCAGAAGGGCGTTTATGTTGGGAACTCGGAGTCTGGGACGACAGCTGGCGGGGCGTCGACGCCTGTGTCTGCGACACGTCAGCAGTCCACGAGGTCTAGGGGAGGTTCGATTGTTATAGGAGGGGATAAAAAGGAGACGGCGACGACTTCACAGGAGAAGAATGTGAG...
Protein
Download Protein FASTA890 aa · TkA03G459980|TK1151|PROTEIN
MIDSLILIDPLASLAAVEDFLWPRVQRSEGSQKGVYVGNSESGTTAGGASTPVSATRQQSTRSRGGSIVIGGDKKETATTSQEKNVSSSKGKGKAVAKSGQEDGSGKGLQTRNAARRRAALDKDAQMKSVDGESTSDDEDFDISPVEIDDALVIEEDDMSEDDDEDHDDVLGEDLPVCMAEKVHDVKLPESTEQRPAGTTTSDAQTNPTSGSSSRGTTAVRGRDRHGRPVFTSNDPPRLVFSSNGKPLNRHLTIYQAIQR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G459980 |
|---|---|
| TK1151 ID | TkA03G459980 |
| OH-1004 ID | LXL04_009655 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 94.700 |
| Protein coverage (%) | TK1151 99.663 / OH-1004 47.614Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G459980 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:114800264-114813200 (-) | |||||||||
| Description | Similar to UPL3: E3 ubiquitin-protein ligase UPL3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0006281 DNA repair Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0010091 trichome branching Biological Process GO:0033696 heterochromatin boundary formation Biological Process GO:0042023 DNA endoreduplication Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0045995 regulation of embryonic development Biological Process GO:0140861 DNA repair-dependent chromatin remodeling Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G38600 ath:AT5G02880 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04889Cwf_Cwc_1580-190 aaPF04046PSP412-436 aaPF00632HECT536-890 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G459980 | PF04889 | Cwf_Cwc_15 | 80 | 190 | 0.25 | 11.8 |
| TkA03G459980 | PF04046 | PSP | 412 | 436 | 0.11 | 13.0 |
| TkA03G459980 | PF00632 | HECT | 536 | 890 | 1.6e-80 | 271.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.