TkA03G452250 | RubberDandelionOmics

Gene overview

TkA03G452250

Reference: TK1151 Chr: Chr03 Coordinates: 112839674-112841445 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · TkA03G452250|TK1151|cDNA

ATGAGATCGCGCCTCCAATTTTCAGTTTTCATTCATCTGTCTCCGTCTCCTCCTCTCTATCGGCGACTCCAAGCAATCGCCTCCATCTCCGTCGTCGGCGTCGCACTGATCCCCTGGTCCGCTGGTCGCACTTCATCTCCAACAGCTCGCACTTCATCTCCGCTGGTCACATCAGTCTCATCTTTAGCGCGAAGAAAATGTATACTTGCTTGCAAGAAACTATGTGCAGATGGAGTTCATGATGTATCTGATCTCTTCGT...

CDS

Download CDS FASTA

645 bp · TkA03G452250|TK1151|CDS

ATGAGATCGCGCCTCCAATTTTCAGTTTTCATTCATCTGTCTCCGTCTCCTCCTCTCTATCGGCGACTCCAAGCAATCGCCTCCATCTCCGTCGTCGGCGTCGCACTGATCCCCTGGTCCGCTGGTCGCACTTCATCTCCAACAGCTCGCACTTCATCTCCGCTGGTCACATCAGTCTCATCTTTAGCGCGAAGAAAATGTATACTTGCTTGCAAGAAACTATGTGCAGATGGAGTTCATGATGTATCTGATCTCTTCGT...

Protein

Download Protein FASTA

214 aa · TkA03G452250|TK1151|PROTEIN

MRSRLQFSVFIHLSPSPPLYRRLQAIASISVVGVALIPWSAGRTSSPTARTSSPLVTSVSSLARRKCILACKKLCADGVHDVSDLFVIFISNENKHVPLWHQKASHRADGIILWDYHVICIQVIRKGGASHVSSKACCEGSKEREYAIDTLQAGNRRRRRKKKKKKRRRRREKEEEKKQVYSIVKGRLRKLNKQEERMHKVRDLSSSFFLQRLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G452250`
TK1151 ID	TkA03G452250
OH-1004 ID	LXL04_009629
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.200
Protein coverage (%)	TK1151 57.477 / OH-1004 62.755 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G452250

Location Chr03:112839674-112841445 (+)

Description Similar to NTAQ1: Protein N-terminal glutamine amidohydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41760`	Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation.	Distinct branches of the N-end rule pathway modulate the plant immune response.2019 · DOI: 10.1111/nph.15387

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AXU2`	Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation.	No verified direct reference in this release
`Os05g0387900`	Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009629 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042742 defense response to bacterium Biological Process

GO:1901183 positive regulation of camalexin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008418 protein-N-terminal asparagine amidohydrolase activity Molecular Function

GO:0070773 protein-N-terminal glutamine amidohydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT2G41760

dosa:Os05g0387900

dya:Dyak_GE11735

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.520

Rank 1 · TkA03G452250 · TK1151

Cytoplasm0.349

Rank 2 · TkA03G452250 · TK1151

Cell membrane0.139

Rank 3 · TkA03G452250 · TK1151

Endoplasmic reticulum0.071

Rank 4 · TkA03G452250 · TK1151

Mitochondrion0.066

Rank 5 · TkA03G452250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09764Nt_Gln_amidase71-126 aa

PF25058ARM_TT21134-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G452250	`PF09764`	Nt_Gln_amidase	71	126	2.4e-17	63.8
TkA03G452250	`PF25058`	ARM_TT21	134	208	0.075	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22944`	Arabidopsis thaliana	sp\|O22944\|NTAQ1_ARATH Protein N-terminal glutamine amidohydrolase	71.400%	Swiss-Prot	Low
`B8AXU2`	Oryza sativa subsp. indica	sp\|B8AXU2\|NTAQ1_ORYSI Protein N-terminal glutamine amidohydrolase	61.300%	Swiss-Prot	Low
`Q60E61`	Oryza sativa subsp. japonica	sp\|Q60E61\|NTAQ1_ORYSJ Protein N-terminal glutamine amidohydrolase	59.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card