TkA03G450310 | RubberDandelionOmics

Gene overview

TkA03G450310

Reference: TK1151 Chr: Chr03 Coordinates: 112376565-112380296 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2081 bp · TkA03G450310|TK1151|cDNA

ATGTGATCATATATTTATGAGATAGACTTATAGAATCAAATCAAATCAAACAAATTCCCAGATAAGATTCACCGGATTCAAAAATCTACACATATCGATTATCATTAATATAAACATATCCAAGCTAACTCGAGAGTTGGAACGCACCACACCTAAATTATTGGCCATCCACCGACCACCGTCGCTGTCGTACCGCCTCCGATCACCGTGGACGAGTGGCCTCCTAACTTAAACTACCATTGACGATTACTACCGTAAGC...

CDS

Download CDS FASTA

1515 bp · TkA03G450310|TK1151|CDS

ATGGCGATCCCGATACCGTCGCGTCAGTTATTCATTGACGGAGAATGGAAAGAGCCTGTTAGGAAGAATCGAATCCCTGTTATCAATCCCGCCACCGAGCAGATCATCGGTGATATCCCAGCAGCTACATCTGAAGATATTGATATTGCTGTGGAAGCTGCTCGTAGAGCTCTTAAACGCAATGGAGGAAAAGACTGGGCATCAGCTACTGGAGCACATCGTGCAAAGTATCTGCGTGCCATTGCTGCAAAGATAACTGA...

Protein

Download Protein FASTA

504 aa · TkA03G450310|TK1151|PROTEIN

MAIPIPSRQLFIDGEWKEPVRKNRIPVINPATEQIIGDIPAATSEDIDIAVEAARRALKRNGGKDWASATGAHRAKYLRAIAAKITEKKSVFAKLEAMDNGKPLDEAAWDIDDVAGCFEYNADLAEALDARQNAPIELPMDTFKCHVIREPIGVVGLITPWNYPLLMATWKIAPALAAGCAAILKPSELASVTCLELGEVCREVGLPPGVLNILTGLGPDAGAPLASHPNVDKIAFTGSSATGSKIMTAAAQNVKPVTLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G450310`
TK1151 ID	TkA03G450310
OH-1004 ID	LXL04_009596
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G450310

Location Chr03:112376565-112380296 (+)

Description Similar to ALDH10A8: Betaine aldehyde dehydrogenase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74920`	Dehydrogenase that catalyzes the oxidation of several aminoaldehydes.	Overexpression of ALDH10A8 and ALDH10A9 Genes Provides Insight into Their Role in Glycine Betaine Synthesis and Affects Primary Metabolism in Arabidopsis thaliana.2015 · DOI: 10.1093/pcp/pcv105 Arabidopsis aldehyde dehydrogenase 10 family members confer salt tolerance through putrescine-derived 4-aminobutyrate (GABA) production.2016 · DOI: 10.1038/srep35115 Roles for ALDH10 enzymes in γ-butyrobetaine synthesis, seed development, germination, and salt tolerance in Arabidopsis.2020 · DOI: 10.1093/jxb/eraa394

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009596 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0019285 glycine betaine biosynthetic process from choline Biological Process

GO:0110095 cellular detoxification of aldehyde Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009516 leucoplast Cellular Component

KEGG gene cross-reference

ath:AT1G74920

ath:AT3G48170

mdm:103455259

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · TkA03G450310 · TK1151

Peroxisome0.183

Rank 2 · TkA03G450310 · TK1151

Nucleus0.180

Rank 3 · TkA03G450310 · TK1151

Plastid0.160

Rank 4 · TkA03G450310 · TK1151

Mitochondrion0.144

Rank 5 · TkA03G450310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171Aldedh19-485 aa

PF09954DUF218850-63 aa

PF07368DUF1487267-455 aa

PF09954DUF2188393-417 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G450310	`PF00171`	Aldedh	19	485	4.3e-171	570.3
TkA03G450310	`PF09954`	DUF2188	50	63	0.031	15.2
TkA03G450310	`PF07368`	DUF1487	267	455	0.0056	16.9
TkA03G450310	`PF09954`	DUF2188	393	417	0.031	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S795`	Arabidopsis thaliana	sp\|Q9S795\|BADH1_ARATH Aminoaldehyde dehydrogenase ALDH10A8, chloroplastic	79.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card