TkA03G441680 | RubberDandelionOmics

Gene overview

TkA03G441680

Reference: TK1151 Chr: Chr03 Coordinates: 110064671-110066946 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

922 bp · TkA03G441680|TK1151|cDNA

TACCTTTATAAGTGAATTGCTTTCAGATTGAGTTTTAAAAGTCAACCACATTATCAACAATGGAGGTTCCTACTGGCTTCCTGGTTATTTCTCTTCTTCTTTGCTTTGCAACTACTGGTTATGGCGTTACCTTCACTTCCCTTCAGAGGACTCTCGTAGTCACCGCTTCACCCACAGAAGGCCAAGTTCTTAAAGCAGGGGATGCAAATATCACAGTGACATGGGGATTCAACCGGACCTTCCCATCTGGAACAGACGCC...

CDS

Download CDS FASTA

606 bp · TkA03G441680|TK1151|CDS

ATGGAGGTTCCTACTGGCTTCCTGGTTATTTCTCTTCTTCTTTGCTTTGCAACTACTGGTTATGGCGTTACCTTCACTTCCCTTCAGAGGACTCTCGTAGTCACCGCTTCACCCACAGAAGGCCAAGTTCTTAAAGCAGGGGATGCAAATATCACAGTGACATGGGGATTCAACCGGACCTTCCCATCTGGAACAGACGCCGACTACAGAACCGTAAAAGTCAAACTATGCTACGCACCCATTAGTCAAAAGGACCGATC...

Protein

Download Protein FASTA

201 aa · TkA03G441680|TK1151|PROTEIN

MEVPTGFLVISLLLCFATTGYGVTFTSLQRTLVVTASPTEGQVLKAGDANITVTWGFNRTFPSGTDADYRTVKVKLCYAPISQKDRSWRKTVDEMKKDKTCQHKIVARPYSASNHTFTSTILRDIPSGTYFVRAYAFNGNDEEVGFGQNTNGKLETNLFVIQAITGRHASLDIASICFSAFSVVALAGFFYMEKSKGKSSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G441680`
TK1151 ID	TkA03G441680
OH-1004 ID	LXL04_009484
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G441680

Location Chr03:110064671-110066946 (-)

Description Similar to NRT3.1: High-affinity nitrate transporter 3.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50200`	Acts as a dual component transporter with NTR2.1.	High-affinity nitrate transport in roots of Arabidopsis depends on expression of the NAR2-like gene AtNRT3.1.2006 · DOI: 10.1104/pp.105.074385 Characterization of a two-component high-affinity nitrate uptake system in Arabidopsis. Physiology and protein-protein interaction.2006 · DOI: 10.1104/pp.106.085209 Regulation of root nitrate uptake at the NRT2.1 protein level in Arabidopsis thaliana.2007 · DOI: 10.1074/jbc.m700901200 Nitrate signaling and the two component high affinity uptake system in Arabidopsis.2007 · DOI: 10.4161/psb.2.4.3870
`At4g24715`	Acts as a dual component transporter with NTR2.1.	High-affinity nitrate transport in roots of Arabidopsis depends on expression of the NAR2-like gene AtNRT3.1.2006 · DOI: 10.1104/pp.105.074385

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0595900`	Acts as a dual component transporter with NTR2.1, NRT2.2 and NRT2.3.	Spatial expression and regulation of rice high-affinity nitrate transporters by nitrogen and carbon status.2011 · DOI: 10.1093/jxb/erq403 Rice OsNAR2.1 interacts with OsNRT2.1, OsNRT2.2 and OsNRT2.3a nitrate transporters to provide uptake over high and low concentration ranges.2011 · DOI: 10.1111/j.1365-3040.2011.02335.x
`Os04g0480200`	Involved in nitrate transport.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009484 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0015112 nitrate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G24715

ath:AT5G50200

dosa:Os02g0595900

dosa:Os04g0480200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.366

Rank 1 · TkA03G441680 · TK1151

Extracellular0.266

Rank 2 · TkA03G441680 · TK1151

Cytoplasm0.246

Rank 3 · TkA03G441680 · TK1151

Lysosome / Vacuole0.174

Rank 4 · TkA03G441680 · TK1151

Endoplasmic reticulum0.171

Rank 5 · TkA03G441680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16974NAR225-166 aa

PF10342Kre9_KNH37-139 aa

PF28718DUF8447118-143 aa

PF28718DUF8447154-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G441680	`PF16974`	NAR2	25	166	2.9e-58	196.2
TkA03G441680	`PF10342`	Kre9_KNH	37	139	0.00015	23.1
TkA03G441680	`PF28718`	DUF8447	118	143	0.19	12.6
TkA03G441680	`PF28718`	DUF8447	154	168	0.19	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGS5`	Arabidopsis thaliana	sp\|Q9FGS5\|NRT31_ARATH High-affinity nitrate transporter 3.1	55.900%	Swiss-Prot	High
`Q9SB67`	Arabidopsis thaliana	sp\|Q9SB67\|NRT32_ARATH High-affinity nitrate transporter 3.2	49.400%	Swiss-Prot	Medium
`Q6ZI50`	Oryza sativa subsp. japonica	sp\|Q6ZI50\|NAR21_ORYSJ High-affinity nitrate transporter-activating protein 2.1	47.900%	Swiss-Prot	Medium
`Q7XK12`	Oryza sativa subsp. japonica	sp\|Q7XK12\|NAR22_ORYSJ Probable high-affinity nitrate transporter-activating protein 2.2	44.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card