TkA03G440960 | RubberDandelionOmics

Gene overview

TkA03G440960

Reference: TK1151 Chr: Chr03 Coordinates: 109868564-109870620 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1619 bp · TkA03G440960|TK1151|cDNA

TTGGATTTACACCAAATTTCTTAAATTTCTCCAACATGAATTATTTTAATTTTATACACATAGAAAACCGATAAATTATACTCCATTATTTTCGTTTAGTTTTTTCTTGTTTTCATTTGGAATAGTTCCTTTGTTTTATTTACACCTCTGGAATCCGAAAACTATTGTGGCCGTCGTCTCTTCACCGGTAACCATCACTTACCTCCATTCTGCTCCCCCATTTAATTCTTGCTGCCCAAACTACACCCTGTTTCTTCAAT...

CDS

Download CDS FASTA

1149 bp · TkA03G440960|TK1151|CDS

ATGGGAGGTGTCACGTCATCAATGGCGGCCAAGTTGGCGTTTTTCCCACCGAATCCACCGTTTTACAAGGTGATTACAGAGAAATCAAGTGGGTTATTGCTCTTGGACAGGTTTCCTCACCGTGAGAATGTCGATGTTCTGAAGCTGCCTACTCGCCGGGGAAATAAGATCGTTGCGGTGTACGTTAGGTATCCCATGGCTACTCGCACTATACTTTATTCCCACGGGAATGCAGCTGATATTGGTCAGATGTATGAACT...

Protein

Download Protein FASTA

382 aa · TkA03G440960|TK1151|PROTEIN

MGGVTSSMAAKLAFFPPNPPFYKVITEKSSGLLLLDRFPHRENVDVLKLPTRRGNKIVAVYVRYPMATRTILYSHGNAADIGQMYELFIDLSIHLKVNLMGYDYSGYGQSSGKPSEHDTYADIEAVYKCLEESYNTKQEDIILYGQSVGSGPTVNLAARLPRLRAVVLHSPILSGLRVMYPVKHTYWFDIYKNIDKIQFVKCPVLVIHGTADEVVDCSHGKQLWELCEEKYEPLWIKGGKHCNLELYPEYIKHLKKFITI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G440960`
TK1151 ID	TkA03G440960
OH-1004 ID	LXL04_009471
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G440960`
Location	Chr03:109868564-109870620 (+)
Description	Similar to abhd17c: Alpha/beta hydrolase domain-containing protein 17C
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009471` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002084 protein depalmitoylation Biological Process GO:1902473 regulation of protein localization to synapse Biological Process GO:1902817 negative regulation of protein localization to microtubule Biological Process GO:1905668 positive regulation of protein localization to endosome Biological Process GO:0005886 plasma membrane Cellular Component GO:0010008 endosome membrane Cellular Component GO:0016020 membrane Cellular Component GO:0055038 recycling endosome membrane Cellular Component GO:0008474 palmitoyl-(protein) hydrolase activity Molecular Function
KEGG gene cross-reference	dre:393126 gga:427252 hsa:51104 xla:446585 xla:447065 xtr:448619 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.534

Rank 1 · TkA03G440960 · TK1151

Cytoplasm0.332

Rank 2 · TkA03G440960 · TK1151

Nucleus0.194

Rank 3 · TkA03G440960 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA03G440960 · TK1151

Golgi apparatus0.060

Rank 5 · TkA03G440960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_469-175 aa

PF00561Abhydrolase_170-190 aa

PF20408Abhydrolase_1170-241 aa

PF12697Abhydrolase_689-174 aa

PF06342DUF105794-177 aa

PF02129Peptidase_S15102-180 aa

PF03583LIP103-155 aa

PF01738DLH116-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G440960	`PF12146`	Hydrolase_4	69	175	3.5e-14	53.4
TkA03G440960	`PF00561`	Abhydrolase_1	70	190	4.1e-09	37.2
TkA03G440960	`PF20408`	Abhydrolase_11	70	241	0.0021	18.5
TkA03G440960	`PF12697`	Abhydrolase_6	89	174	0.013	16.9
TkA03G440960	`PF06342`	DUF1057	94	177	0.033	13.9
TkA03G440960	`PF02129`	Peptidase_S15	102	180	0.0012	19.3
TkA03G440960	`PF03583`	LIP	103	155	0.04	14.0
TkA03G440960	`PF01738`	DLH	116	227	0.00042	20.7
TkA03G440960	`PF00326`	Peptidase_S9	117	228	1.2e-05	25.6
TkA03G440960	`PF20434`	BD-FAE	118	150	0.0062	16.8
TkA03G440960	`PF07859`	Abhydrolase_3	120	173	0.28	11.6
TkA03G440960	`PF00756`	Esterase	125	232	0.033	14.7
TkA03G440960	`PF08840`	BAAT_C	127	199	0.14	12.9
TkA03G440960	`PF03959`	FSH1	160	239	0.00012	22.6
TkA03G440960	`PF12695`	Abhydrolase_5	186	247	0.27	11.7
TkA03G440960	`PF00561`	Abhydrolase_1	187	232	4.1e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card