TkA03G439780 | RubberDandelionOmics

Gene overview

TkA03G439780

Reference: TK1151 Chr: Chr03 Coordinates: 109386008-109388087 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1073 bp · TkA03G439780|TK1151|cDNA

AAGAAATAGTCCAGGGACCATTTCTGTAAATTATTCCGATGAAAACCCAAAGAAAGAACAGGCCAACAGCATTTCATTATCAGCTGAAGTGGAGGAAAATGGAGAGCGTAATGACATTAGGATTAGGAAGGTCCCCATGTGTTTCGCCGTCGTTATCTTCAATCCGATTATCATCTTCATCCGACACCAGTATTAGCTTATCCTTACCCACCACCGCCGTCTCCGCATCCAGCCACCGTCATCTAGCTGCATTTCAACCG...

CDS

Download CDS FASTA

774 bp · TkA03G439780|TK1151|CDS

ATGAAAACCCAAAGAAAGAACAGGCCAACAGCATTTCATTATCAGCTGAAGTGGAGGAAAATGGAGAGCGTAATGACATTAGGATTAGGAAGGTCCCCATGTGTTTCGCCGTCGTTATCTTCAATCCGATTATCATCTTCATCCGACACCAGTATTAGCTTATCCTTACCCACCACCGCCGTCTCCGCATCCAGCCACCGTCATCTAGCTGCATTTCAACCGGCGTCTCATCTTTTCTCCAATTCAGTATCGCCTCGTAT...

Protein

Download Protein FASTA

257 aa · TkA03G439780|TK1151|PROTEIN

MKTQRKNRPTAFHYQLKWRKMESVMTLGLGRSPCVSPSLSSIRLSSSSDTSISLSLPTTAVSASSHRHLAAFQPASHLFSNSVSPRIHAAKKKKNPHIFLPHLVASMQVEESYIMIKPDGVQRGLVGEIISRFEKKGFKLKGLKLFECPKELAEEHYKDLSSKPFFPSLISYITSGPVVCMAWEGVGVVASARKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIALWFKEGELTEWTPVQTPWLIE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G439780`
TK1151 ID	TkA03G439780
OH-1004 ID	LXL04_009431
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G439780

Location Chr03:109386008-109388087 (+)

Description Similar to NDPK2: Nucleoside diphosphate kinase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63310`	Major role in the synthesis of nucleoside triphosphates other than ATP.	NDP kinase 2 interacts with two oxidative stress-activated MAPKs to regulate cellular redox state and enhances multiple stress tolerance in transgenic plants.2003 · DOI: 10.1073/pnas.252641899

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009431 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006183 GTP biosynthetic process Biological Process

GO:0006228 UTP biosynthetic process Biological Process

GO:0006241 CTP biosynthetic process Biological Process

GO:0009411 response to UV Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT5G63310

nta:107768038

tel:tlr0267

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.964

Rank 1 · TkA03G439780 · TK1151

Mitochondrion0.054

Rank 2 · TkA03G439780 · TK1151

Nucleus0.021

Rank 3 · TkA03G439780 · TK1151

Cytoplasm0.018

Rank 4 · TkA03G439780 · TK1151

Cell membrane0.011

Rank 5 · TkA03G439780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00334NDK110-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G439780	`PF00334`	NDK	110	243	4.8e-55	185.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64903`	Arabidopsis thaliana	sp\|O64903\|NDK2_ARATH Nucleoside diphosphate kinase II, chloroplastic	78.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card