TkA03G435690 | RubberDandelionOmics

Gene overview

TkA03G435690

Reference: TK1151 Chr: Chr03 Coordinates: 108391090-108392724 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1228 bp · TkA03G435690|TK1151|cDNA

CCACCATGCAAGATTTATCACTATTTAAACGAACCTCGATCTTTACATTATGCATTCATACATTCATCTCCACATAAATTATGGCTCCCGAAATTAACAGAGAGAAACTTAGTTCCGAAGAAGCCGCAGCCGTCAAAGAAATATGGATGAGATACGTTCTTGTTTCACCCCCATGGCCGTCGTTAAATGTGCCATCGAGCTCCAAATACCCGACATCCTCCAAAAACATGAAACCCCCATCACACTTTCCGAACTTGCAT...

CDS

Download CDS FASTA

1005 bp · TkA03G435690|TK1151|CDS

ATGGATGAGATACGTTCTTGTTTCACCCCCATGGCCGTCGTTAAATGTGCCATCGAGCTCCAAATACCCGACATCCTCCAAAAACATGAAACCCCCATCACACTTTCCGAACTTGCATCCGAGCTCGGATGTTCATGTTCCTCTTCATCATTGTATAGAATCATGAGGTTCTTGATTCAATATAACATATTTCAAGAAAAACCCATATCAGAAACTTCCGTTGGATACTCTCAAACACCATTGTCCCGGCTTCTAACCAG...

Protein

Download Protein FASTA

334 aa · TkA03G435690|TK1151|PROTEIN

MDEIRSCFTPMAVVKCAIELQIPDILQKHETPITLSELASELGCSCSSSSLYRIMRFLIQYNIFQEKPISETSVGYSQTPLSRLLTRDANHSMADLVLLETSPIMLAPWQKLSASVLGNGESAFRAAHGDDLWKLAAGNPGHSKLIEDAMACDARMAVEAVIEGCPEVFEGLKTVVDVGGGDGTALKMIVEGSPWMKGINFDLPHVVSVAPLWNGVEHVGGDMFDHIPKADAAYLMKVLHDWGDEECIDILRKCRNAISK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G435690`
TK1151 ID	TkA03G435690
OH-1004 ID	LXL04_009417
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.904 / OH-1004 92.113 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G435690

Location Chr03:108391090-108392724 (-)

Description Similar to ASMT: Acetylserotonin O-methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35160`	Methyltransferase which catalyzes the transfer of a methyl group onto N-acetylserotonin, producing melatonin (N-acetyl-5- methoxytryptamine).	Cloning and functional characterization of the Arabidopsis N-acetylserotonin O-methyltransferase responsible for melatonin synthesis.2016 · DOI: 10.1111/jpi.12289 Daily rhythms of phytomelatonin signaling modulate diurnal stomatal closure via regulating reactive oxygen species dynamics in Arabidopsis.2020 · DOI: 10.1111/jpi.12640 Melatonin inhibits seed germination by crosstalk with abscisic acid, gibberellin, and auxin in Arabidopsis.2021 · DOI: 10.1111/jpi.12736 Roles of Endogenous Melatonin in Resistance to Botrytis cinerea Infection in an Arabidopsis Model.2021 · DOI: 10.3389/fpls.2021.683228

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009417 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010555 response to mannitol Biological Process

GO:0030187 melatonin biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008171 O-methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G35160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.836

Rank 1 · TkA03G435690 · TK1151

Nucleus0.307

Rank 2 · TkA03G435690 · TK1151

Endoplasmic reticulum0.046

Rank 3 · TkA03G435690 · TK1151

Mitochondrion0.045

Rank 4 · TkA03G435690 · TK1151

Peroxisome0.041

Rank 5 · TkA03G435690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08100Dimerisation8-87 aa

PF08279HTH_1120-45 aa

PF23159WHD_Rok21-56 aa

PF00891Methyltransf_2109-315 aa

PF13238AAA_18143-169 aa

PF13489Methyltransf_23169-316 aa

PF13238AAA_18241-304 aa

PF23628ARM_LIN_C246-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G435690	`PF08100`	Dimerisation	8	87	1.9e-18	66.9
TkA03G435690	`PF08279`	HTH_11	20	45	0.01	16.4
TkA03G435690	`PF23159`	WHD_Rok	21	56	0.049	14.3
TkA03G435690	`PF00891`	Methyltransf_2	109	315	1.6e-50	172.1
TkA03G435690	`PF13238`	AAA_18	143	169	0.11	13.7
TkA03G435690	`PF13489`	Methyltransf_23	169	316	0.0032	17.9
TkA03G435690	`PF13238`	AAA_18	241	304	0.11	13.7
TkA03G435690	`PF23628`	ARM_LIN_C	246	296	0.014	15.1
TkA03G435690	`PF23159`	WHD_Rok	246	258	0.049	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T003`	Arabidopsis thaliana	sp\|Q9T003\|ASMT_ARATH Acetylserotonin O-methyltransferase	49.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card