TkA03G434830 | RubberDandelionOmics

Gene overview

TkA03G434830

Reference: TK1151 Chr: Chr03 Coordinates: 108203353-108205940 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1923 bp · TkA03G434830|TK1151|cDNA

CCATAAATGATTAAACAGAAAGACTAAAACCCTATAGAGAGCGAGAGAGAAAAGCGACGCCAAAACCCTAAACTCCAGCTGAACTTTGAGGTTTTGCTCTTCAATGGCGTTGTATATCTTATACGAATCTGCCTCCGGCCACGCATTGTTTTTGGCCCACGGAATAGACGAAATCGGACAGAATACGGAGGCTGTTCGGAACTCCGTAGTCGACCTCAATCGGTTCGGAAAGGTTGTAAAACTCGCGGCTTTTAATCCTT...

CDS

Download CDS FASTA

1569 bp · TkA03G434830|TK1151|CDS

ATGGCGTTGTATATCTTATACGAATCTGCCTCCGGCCACGCATTGTTTTTGGCCCACGGAATAGACGAAATCGGACAGAATACGGAGGCTGTTCGGAACTCCGTAGTCGACCTCAATCGGTTCGGAAAGGTTGTAAAACTCGCGGCTTTTAATCCTTTCGAATCGGCTCTCGATGCTCTCAACCAGTGCAGTGCCGTCTCAGAAGGCCAAATGACTGAAGAACTGAGGAACTTTCTGGAACTCAGCCTTCCCAAAGTGAA...

Protein

Download Protein FASTA

522 aa · TkA03G434830|TK1151|PROTEIN

MALYILYESASGHALFLAHGIDEIGQNTEAVRNSVVDLNRFGKVVKLAAFNPFESALDALNQCSAVSEGQMTEELRNFLELSLPKVKEGKKPKYSLGVADPKIGSHIYEETKIPCQSNEFVLELIRGVRFHFDRFIENLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNSFSMRVREWYSWHFPELVKIVNDNYLYAKLAKYINDKSELSEDKLEGLIDILGDEDKAKEVIEAAKASMGQDLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G434830`
TK1151 ID	TkA03G434830
OH-1004 ID	LXL04_009411
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G434830`
Location	Chr03:108203353-108205940 (+)
Description	Similar to NOP56: Nucleolar protein 56
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009411` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000451 rRNA 2'-O-methylation Biological Process GO:0000452 snoRNA guided rRNA 2'-O-methylation Biological Process GO:0006364 rRNA processing Biological Process GO:0016556 mRNA modification Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0001650 fibrillar center Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005732 sno(s)RNA-containing ribonucleoprotein complex Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	bta:404165 hsa:10528 pon:100172744 spo:2541087 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.799

Rank 1 · TkA03G434830 · TK1151

Cytoplasm0.226

Rank 2 · TkA03G434830 · TK1151

Cell membrane0.033

Rank 3 · TkA03G434830 · TK1151

Mitochondrion0.029

Rank 4 · TkA03G434830 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA03G434830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08156NOP5NT4-69 aa

PF01798Nop177-409 aa

PF222426PGD_like220-268 aa

PF15377DUF4604426-518 aa

PF01798Nop481-498 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G434830	`PF08156`	NOP5NT	4	69	2.2e-20	73.5
TkA03G434830	`PF01798`	Nop	177	409	7.6e-89	297.8
TkA03G434830	`PF22242`	6PGD_like	220	268	0.22	12.6
TkA03G434830	`PF15377`	DUF4604	426	518	5.0	8.2
TkA03G434830	`PF01798`	Nop	481	498	7.6e-89	297.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card