TkA03G434440 | RubberDandelionOmics

Gene overview

TkA03G434440

Reference: TK1151 Chr: Chr03 Coordinates: 108098587-108101205 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2464 bp · TkA03G434440|TK1151|cDNA

TTGTCTTTTAAACATCCAGAGTGTGGGTACGTTATAGATATTGGCGATGAATCCGATATATGTCAACTGAAGACTGTGATTGAAGAAACGAAGAAAAATGTCCATTTGTATTTGACTGATGGTGGTTTGGTTACCGACGAACAGAATCTTCAAATTAATGAAGCAAATACTGGTGTTGTGTCAGGGCAGAATTTAAATGACACAAATTATTCCAATCAAGAATTTGGTGATGCTGTTTCTGAGGAAGAAGAAGCAGAAAA...

CDS

Download CDS FASTA

2334 bp · TkA03G434440|TK1151|CDS

TTGTCTTTTAAACATCCAGAGTGTGGGTACGTTATAGATATTGGCGATGAATCCGATATATGTCAACTGAAGACTGTGATTGAAGAAACGAAGAAAAATGTCCATTTGTATTTGACTGATGGTGGTTTGGTTACCGACGAACAGAATCTTCAAATTAATGAAGCAAATACTGGTGTTGTGTCAGGGCAGAATTTAAATGACACAAATTATTCCAATCAAGAATTTGGTGATGCTGTTTCTGAGGAAGAAGAAGCAGAAAA...

Protein

Download Protein FASTA

777 aa · TkA03G434440|TK1151|PROTEIN

LSFKHPECGYVIDIGDESDICQLKTVIEETKKNVHLYLTDGGLVTDEQNLQINEANTGVVSGQNLNDTNYSNQEFGDAVSEEEEAENEEEENYPMTQVQHDELLDGGEATGFGLDVSDEEKSDEAWSEDEYTRPRASNPFYGMAPIPDDPEPVYEQGPFHSTGPNDKLIVRQSFDTKKDLVLACKMKAVREQFQFTTSRSTKKRYEIVCKLENCSWRLCATNILGSEMFEIRSFNEKHTCSSLQIHPNHRQANTDVLGTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G434440`
TK1151 ID	TkA03G434440
OH-1004 ID	LXL04_039716
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	34.400
Protein coverage (%)	TK1151 91.634 / OH-1004 78.394 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G434440`
Location	Chr03:108098587-108101205 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039716` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · TkA03G434440 · TK1151

Cytoplasm0.125

Rank 2 · TkA03G434440 · TK1151

Cell membrane0.020

Rank 3 · TkA03G434440 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA03G434440 · TK1151

Mitochondrion0.012

Rank 5 · TkA03G434440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03108DBD_Tnp_Mut166-231 aa

PF10551MULE285-341 aa

PF21056ZSWIM1-3_RNaseH-like323-444 aa

PF10551MULE364-456 aa

PF00872Transposase_mut381-496 aa

PF04434SWIM612-639 aa

PF30379SLU7_N713-729 aa

PF00098zf-CCHC714-730 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G434440	`PF03108`	DBD_Tnp_Mut	166	231	1.2e-07	32.0
TkA03G434440	`PF10551`	MULE	285	341	3.3e-17	63.4
TkA03G434440	`PF21056`	ZSWIM1-3_RNaseH-like	323	444	0.14	12.8
TkA03G434440	`PF10551`	MULE	364	456	3.3e-17	63.4
TkA03G434440	`PF00872`	Transposase_mut	381	496	3.2e-07	30.3
TkA03G434440	`PF04434`	SWIM	612	639	8.4e-08	32.3
TkA03G434440	`PF30379`	SLU7_N	713	729	0.12	12.5
TkA03G434440	`PF00098`	zf-CCHC	714	730	0.03	15.1
TkA03G434440	`PF14787`	zf-CCHC_5	715	730	0.63	10.5
TkA03G434440	`PF21759`	AIR2-like_ZnK4	716	732	0.058	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card