TkA03G430440 | RubberDandelionOmics

Gene overview

TkA03G430440

Reference: TK1151 Chr: Chr03 Coordinates: 107137110-107140208 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1998 bp · TkA03G430440|TK1151|cDNA

TTGTGTGCATACGGCAGCCTTCTTGTCTGCAAGGTTTTATTAAATTTCCTGCCACTTCTTTTTGCTTTCAGCTTCAAAATAGTGAAAAAGCTTCCATCTTTACCAAAACCCACCATGGGAAGAACCAGAAAAGCTTCATTTTCATCCATTTTCTTGCTACTTTTCACAGTTTCTAGTCTACTTGATCCGACCCGGTTCGCAAATGCATCGGGTCAAGATCAACAACCCATCAAGAGGATAGTGGTGTTAGTTCTTGAAAA...

CDS

Download CDS FASTA

1713 bp · TkA03G430440|TK1151|CDS

TTGTGTGCATACGGCAGCCTTCTTGTCTGCAAGGTTTTATTAAATTTCCTGCCACTTCTTTTTGCTTTCAGCTTCAAAATAGTGAAAAAGCTTCCATCTTTACCAAAACCCACCATGGGAAGAACCAGAAAAGCTTCATTTTCATCCATTTTCTTGCTACTTTTCACAGTTTCTAGTCTACTTGATCCGACCCGGTTCGCAAATGCATCGGGTCAAGATCAACAACCCATCAAGAGGATAGTGGTGTTAGTTCTTGAAAA...

Protein

Download Protein FASTA

570 aa · TkA03G430440|TK1151|PROTEIN

LCAYGSLLVCKVLLNFLPLLFAFSFKIVKKLPSLPKPTMGRTRKASFSSIFLLLFTVSSLLDPTRFANASGQDQQPIKRIVVLVLENRSFDHMIGWMKKSINPSINGVTGRECNPVSTNLTRKEPQETQESSSSSICFTDDAKYVDPDPGHSFEDVEKQVFGSNRIPSMSGFVEQASSVSPDLSETVMKGFRPENVPIFAKLVQEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAKGYPQKTIFDSLHENG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G430440`
TK1151 ID	TkA03G430440
OH-1004 ID	LXL04_009373
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 99.825 / OH-1004 99.825 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G430440

Location Chr03:107137110-107140208 (+)

Description Similar to NPC6: Non-specific phospholipase C6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48610`	Non-specific phospholipase C6.	No verified direct reference in this release
`At2g26870`	Non-specific phospholipase C2.	No verified direct reference in this release
`At1g07230`	Non-specific phospholipase C1.	No verified direct reference in this release
`At3g03520`	Possesses specific phosphatase activity toward lysophosphatidic acid (LPA) in vitro.	Functional characterization of lysophosphatidic acid phosphatase from Arabidopsis thaliana.2010 · DOI: 10.1016/j.bbalip.2009.12.005 Plant phosphatidylcholine-hydrolyzing phospholipases C NPC3 and NPC4 with roles in root development and brassinolide signaling in Arabidopsis thaliana.2010 · DOI: 10.1093/mp/ssq005
`At3g03530`	Non-specific phospholipase C (PLC) which assumes major PLC activity during inorganic phosphate starvation.	A novel phosphatidylcholine-hydrolyzing phospholipase C induced by phosphate starvation in Arabidopsis.2005 · DOI: 10.1074/jbc.m408799200 Plant phosphatidylcholine-hydrolyzing phospholipases C NPC3 and NPC4 with roles in root development and brassinolide signaling in Arabidopsis thaliana.2010 · DOI: 10.1093/mp/ssq005 Nonspecific phospholipase C NPC4 promotes responses to abscisic acid and tolerance to hyperosmotic stress in Arabidopsis.2010 · DOI: 10.1105/tpc.109.071720 The phosphatidylcholine-hydrolysing phospholipase C NPC4 plays a role in response of Arabidopsis roots to salt stress.2011 · DOI: 10.1093/jxb/err039

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009373 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006796 phosphate-containing compound metabolic process Biological Process

GO:0009395 phospholipid catabolic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048229 gametophyte development Biological Process

GO:0048364 root development Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G07230

ath:AT2G26870

ath:AT3G03520

ath:AT3G03530

ath:AT3G48610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.415

Rank 1 · TkA03G430440 · TK1151

Extracellular0.217

Rank 2 · TkA03G430440 · TK1151

Cytoplasm0.148

Rank 3 · TkA03G430440 · TK1151

Cell membrane0.148

Rank 4 · TkA03G430440 · TK1151

Endoplasmic reticulum0.131

Rank 5 · TkA03G430440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04185Phosphoesterase77-441 aa

PF17273DUF5338238-261 aa

PF17273DUF5338290-299 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G430440	`PF04185`	Phosphoesterase	77	441	3e-107	359.6
TkA03G430440	`PF17273`	DUF5338	238	261	0.013	16.3
TkA03G430440	`PF17273`	DUF5338	290	299	0.013	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H965`	Arabidopsis thaliana	sp\|Q8H965\|NPC6_ARATH Non-specific phospholipase C6	73.800%	Swiss-Prot	High
`O81020`	Arabidopsis thaliana	sp\|O81020\|NPC2_ARATH Non-specific phospholipase C2	59.200%	Swiss-Prot	High
`Q8L7Y9`	Arabidopsis thaliana	sp\|Q8L7Y9\|NPC1_ARATH Non-specific phospholipase C1	58.400%	Swiss-Prot	High
`Q9SRQ6`	Arabidopsis thaliana	sp\|Q9SRQ6\|NPC3_ARATH Non-specific phospholipase C3	52.900%	Swiss-Prot	High
`Q9SRQ7`	Arabidopsis thaliana	sp\|Q9SRQ7\|NPC4_ARATH Non-specific phospholipase C4	52.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card