TkA03G427740 | RubberDandelionOmics

Gene overview

TkA03G427740

Reference: TK1151 Chr: Chr03 Coordinates: 106373102-106374038 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

531 bp · TkA03G427740|TK1151|cDNA

ATGAAGAAAAACTCATCGTCAACGCAGCAAATCGCATTGGTAACGGCAACAATATCAGTATCACTACTCTTGATCATAATGATTGCCATCGTTACAGGCGTAACGCAATATGGCCGTGTTATCGTAAACCCTAAGAGCAGAACTAAATCTGGTTTCCATCGCAAGCTTCTTCTCCATGATAATTCAGAAACGGGTGAAGTGCTACCAAATCGAATTTGGGGGGACAAATGCTCGAAATCCGACATTGTCATTAACCAGGG...

CDS

Download CDS FASTA

531 bp · TkA03G427740|TK1151|CDS

ATGAAGAAAAACTCATCGTCAACGCAGCAAATCGCATTGGTAACGGCAACAATATCAGTATCACTACTCTTGATCATAATGATTGCCATCGTTACAGGCGTAACGCAATATGGCCGTGTTATCGTAAACCCTAAGAGCAGAACTAAATCTGGTTTCCATCGCAAGCTTCTTCTCCATGATAATTCAGAAACGGGTGAAGTGCTACCAAATCGAATTTGGGGGGACAAATGCTCGAAATCCGACATTGTCATTAACCAGGG...

Protein

Download Protein FASTA

176 aa · TkA03G427740|TK1151|PROTEIN

MKKNSSSTQQIALVTATISVSLLLIIMIAIVTGVTQYGRVIVNPKSRTKSGFHRKLLLHDNSETGEVLPNRIWGDKCSKSDIVINQGPTSPLPNGIPTYTVEIMNVCTTGCDISDIHLSCGWFSSARLINPHLFKRLSYNDCLVNDGNPLMNGRTVSFQYANTFAYPLSISSVICR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G427740`
TK1151 ID	TkA03G427740
OH-1004 ID	LXL04_009342
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 84.659 / OH-1004 42.816 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G427740

Location Chr03:106373102-106374038 (-)

Description Similar to TDL1: TPD1 protein homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32583`	TPD1 protein homolog 1.	No verified direct reference in this release
`At4g24972`	Involved in cell specification during anther and pollen development.	Tapetum determinant1 is required for cell specialization in the Arabidopsis anther.2003 · DOI: 10.1105/tpc.016618 Overexpression of TAPETUM DETERMINANT1 alters the cell fates in the Arabidopsis carpel and tapetum via genetic interaction with excess microsporocytes1/extra sporogenous cells.2005 · DOI: 10.1104/pp.105.063529 Signaling of cell fate determination by the TPD1 small protein and EMS1 receptor kinase.2008 · DOI: 10.1073/pnas.0708795105

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0207500`	May play a role during anther development.	No verified direct reference in this release
`Os12g0472500`	Involved in cell specification during anther development.	OsTDL1A binds to the LRR domain of rice receptor kinase MSP1, and is required to limit sporocyte numbers.2008 · DOI: 10.1111/j.1365-313x.2008.03426.x MIL2 (MICROSPORELESS2) regulates early cell differentiation in the rice anther.2012 · DOI: 10.1111/j.1469-8137.2012.04270.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009342 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001709 cell fate determination Biological Process

GO:0009408 response to heat Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0010234 anther wall tapetum cell fate specification Biological Process

GO:0048653 anther development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G05835

ath:AT1G32583

ath:AT4G24972

dosa:Os10g0207500

dosa:Os12g0472500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.373

Rank 1 · TkA03G427740 · TK1151

Cell membrane0.175

Rank 2 · TkA03G427740 · TK1151

Endoplasmic reticulum0.169

Rank 3 · TkA03G427740 · TK1151

Cytoplasm0.120

Rank 4 · TkA03G427740 · TK1151

Lysosome / Vacuole0.118

Rank 5 · TkA03G427740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24068TPD1_C78-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G427740	`PF24068`	TPD1_C	78	175	1.6e-42	144.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1G3T1`	Arabidopsis thaliana	sp\|Q1G3T1\|TDL1_ARATH TPD1 protein homolog 1	56.900%	Swiss-Prot	High
`Q6TLJ2`	Arabidopsis thaliana	sp\|Q6TLJ2\|TPD1_ARATH Protein TAPETUM DETERMINANT 1	59.100%	Swiss-Prot	Medium
`Q8S6P9`	Oryza sativa subsp. japonica	sp\|Q8S6P9\|TDL1B_ORYSJ TPD1 protein homolog 1B	48.200%	Swiss-Prot	Medium
`Q2QR54`	Oryza sativa subsp. japonica	sp\|Q2QR54\|TDL1A_ORYSJ TPD1 protein homolog 1A	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card