TkA03G416960 | RubberDandelionOmics

Gene overview

TkA03G416960

Reference: TK1151 Chr: Chr03 Coordinates: 103752808-103760745 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1117 bp · TkA03G416960|TK1151|cDNA

AACACAACATTACGACGCCGTAAAGTCGATGAAATAGTGAAATCCTTTCTAACACCTCCTAATCTCATAATACCCCTACACACCAACCAAAGAAAACTCTTCTTCTTTCACCTACACACCTCTCAATGGCTGCTGTTACAATGACTTGTGTTGGATTGACGACTTCCATGCACACCAACCAGATCATAGGGAAACCTTCAATGCTGAAATTGGTCCCACTCGGTCGCACTACTTGCTTGAGAGCGTCACGCTTTCAAATC...

CDS

Download CDS FASTA

402 bp · TkA03G416960|TK1151|CDS

ATGGCTGCTGTTACAATGACTTGTGTTGGATTGACGACTTCCATGCACACCAACCAGATCATAGGGAAACCTTCAATGCTGAAATTGGTCCCACTCGGTCGCACTACTTGCTTGAGAGCGTCACGCTTTCAAATCTCTTGCGCAGCAAAGCCAGAAACAGTGAGCAAAGTTTGTGAAATTGTTAAGACTCAATTGGCTTTGTCAGCCGACTCTGTTGTTGAACCCGACTCTAAATTCGCAGCCCTTGGTGCTGATTCCCT...

Protein

Download Protein FASTA

133 aa · TkA03G416960|TK1151|PROTEIN

MAAVTMTCVGLTTSMHTNQIIGKPSMLKLVPLGRTTCLRASRFQISCAAKPETVSKVCEIVKTQLALSADSVVEPDSKFAALGADSLDTVEIVMTLEEEFGISVEEENSQNITTVQEAADLIEKLVEKKNATA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G416960`
TK1151 ID	TkA03G416960
OH-1004 ID	LXL04_005958
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.500
Protein coverage (%)	TK1151 66.917 / OH-1004 50.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G416960

Location Chr03:103752808-103760745 (-)

Description Similar to ACP1: Acyl carrier protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25050`	Carrier of the growing fatty acid chain in fatty acid biosynthesis that plays a major role in the biosynthesis of fatty acids in leaves.	Expression of antisense acyl carrier protein-4 reduces lipid content in Arabidopsis leaf tissue.2003 · DOI: 10.1104/pp.102.018622 An intact cuticle in distal tissues is essential for the induction of systemic acquired resistance in plants.2009 · DOI: 10.1016/j.chom.2009.01.001

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005958 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009507 chloroplast Cellular Component

GO:0000036 acyl carrier activity Molecular Function

GO:0031177 phosphopantetheine binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.986

Rank 1 · TkA03G416960 · TK1151

Mitochondrion0.024

Rank 2 · TkA03G416960 · TK1151

Nucleus0.012

Rank 3 · TkA03G416960 · TK1151

Cytoplasm0.012

Rank 4 · TkA03G416960 · TK1151

Cell membrane0.007

Rank 5 · TkA03G416960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16320Ribosomal_L12_N42-49 aa

PF00550PP-binding56-122 aa

PF23297ACP_SdgA_C56-131 aa

PF14573PP-binding_285-123 aa

PF16320Ribosomal_L12_N87-103 aa

PF26347YtrI_C96-131 aa

PF16320Ribosomal_L12_N114-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G416960	`PF16320`	Ribosomal_L12_N	42	49	0.032	14.7
TkA03G416960	`PF00550`	PP-binding	56	122	1.6e-12	48.2
TkA03G416960	`PF23297`	ACP_SdgA_C	56	131	0.001	19.8
TkA03G416960	`PF14573`	PP-binding_2	85	123	4.8e-06	27.4
TkA03G416960	`PF16320`	Ribosomal_L12_N	87	103	0.032	14.7
TkA03G416960	`PF26347`	YtrI_C	96	131	0.068	14.5
TkA03G416960	`PF16320`	Ribosomal_L12_N	114	128	0.032	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SW21`	Arabidopsis thaliana	sp\|Q9SW21\|ACP4_ARATH Acyl carrier protein 4, chloroplastic	63.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card