TkA03G415670 | RubberDandelionOmics

Gene overview

TkA03G415670

Reference: TK1151 Chr: Chr03 Coordinates: 103394702-103398126 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1416 bp · TkA03G415670|TK1151|cDNA

TTGTTAAAATATTGAAAATTTTCTTATAGATGAGTTAAGATTCATCTATTTGTCTCTTATTATCAATACATTAACTCTGAACTCATCATCCATAACTCTTACAATAACATTTTGCCTTCTTATATACGATCAATTCCGTATAAATCGATTTCTACATTTCAATCTTGGTCGGAGATCTGTAGTAGAGGAACTGGAGAGGACGATTATGGTGGGATACCAGAAATCCGGCTCCGTCATGAAAGCACTTCGCCAGAGTAAAG...

CDS

Download CDS FASTA

534 bp · TkA03G415670|TK1151|CDS

ATGGTGGGATACCAGAAATCCGGCTCCGTCATGAAAGCACTTCGCCAGAGTAAAGAAATGTGTTCTAAAGTGATCAGAGAGAAGAGACTGGATGAAGTATGTCTTGAACGATTCAACCAATACAGTCGAAACTACATCCAATCATGGATCCTCCAAGGCAAAGTAATTGTTAATGGGAAAGTTGCAACTAAAGCCGGACACCCAGTTTCCGATAAGTCAATTGTGGAAATCAAGGCTGAAATCCCGAAATATGTATGTAG...

Protein

Download Protein FASTA

177 aa · TkA03G415670|TK1151|PROTEIN

MVGYQKSGSVMKALRQSKEMCSKVIREKRLDEVCLERFNQYSRNYIQSWILQGKVIVNGKVATKAGHPVSDKSIVEIKAEIPKYVCRAGHKLEAAIEQLGIDVNGYFWNVSRYRNHEELHNLMKATLMIHRLKKDVLTELLSNEGNRVPNYISLFDFLRRSEGVEAACKHYMDTFMS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G415670`
TK1151 ID	TkA03G415670
OH-1004 ID	LXL04_036695
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.800
Protein coverage (%)	TK1151 45.198 / OH-1004 25.641 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G415670`
Location	Chr03:103394702-103398126 (-)
Description	Similar to tlyA: Hemolysin A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036695` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000451 rRNA 2'-O-methylation Biological Process GO:0001897 symbiont-mediated cytolysis of host cell Biological Process GO:0006364 rRNA processing Biological Process GO:0016032 viral process Biological Process GO:0031167 rRNA methylation Biological Process GO:0031640 killing of cells of another organism Biological Process GO:0032259 methylation Biological Process GO:0042256 cytosolic ribosome assembly Biological Process GO:0048870 cell motility Biological Process GO:0071236 cellular response to antibiotic Biological Process GO:0005737 cytoplasm Cellular Component GO:0020002 host cell plasma membrane Cellular Component
KEGG gene cross-reference	bsu:BSU24260 cjj:CJJ81176_0616 mtc:MT1733 mtu:Rv1694 mtv:RVBD_1694 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.389

Rank 1 · TkA03G415670 · TK1151

Mitochondrion0.338

Rank 2 · TkA03G415670 · TK1151

Cytoplasm0.226

Rank 3 · TkA03G415670 · TK1151

Cell membrane0.020

Rank 4 · TkA03G415670 · TK1151

Plastid0.020

Rank 5 · TkA03G415670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26845Phage_phi29_DNA_rep112-59 aa

PF01479S429-71 aa

PF13275S4_249-79 aa

PF01479S480-89 aa

PF13275S4_286-105 aa

PF26845Phage_phi29_DNA_rep1128-150 aa

PF13275S4_2150-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G415670	`PF26845`	Phage_phi29_DNA_rep1	12	59	0.16	13.2
TkA03G415670	`PF01479`	S4	29	71	1.4e-10	41.5
TkA03G415670	`PF13275`	S4_2	49	79	0.14	12.8
TkA03G415670	`PF01479`	S4	80	89	1.4e-10	41.5
TkA03G415670	`PF13275`	S4_2	86	105	0.14	12.8
TkA03G415670	`PF26845`	Phage_phi29_DNA_rep1	128	150	0.16	13.2
TkA03G415670	`PF13275`	S4_2	150	161	0.14	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card