TkA03G413660 | RubberDandelionOmics

Gene overview

TkA03G413660

Reference: TK1151 Chr: Chr03 Coordinates: 102877526-102878110 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · TkA03G413660|TK1151|cDNA

ATGTGCCCAACCGACACATCCCCTCATAAAACCATGTTCATCAATGGGTTCCCTTGCAAGAACCCATCAAACATCACGACATCTGATTTCAAGAATATGCATTTAAGCCATAAAGGTAGCACCGACACGTTCCTACAGTCGTCTGTCGCCATAGTCACCGCGTCTGAGTTCCCAGGGCTTAACACTTTAGGGTTGTCAACTGGTAGGACCGATTTAGAAGTTGATGGGTTAGTGATGCCTCACACGCACCCAAGATCGAG...

CDS

Download CDS FASTA

585 bp · TkA03G413660|TK1151|CDS

ATGTGCCCAACCGACACATCCCCTCATAAAACCATGTTCATCAATGGGTTCCCTTGCAAGAACCCATCAAACATCACGACATCTGATTTCAAGAATATGCATTTAAGCCATAAAGGTAGCACCGACACGTTCCTACAGTCGTCTGTCGCCATAGTCACCGCGTCTGAGTTCCCAGGGCTTAACACTTTAGGGTTGTCAACTGGTAGGACCGATTTAGAAGTTGATGGGTTAGTGATGCCTCACACGCACCCAAGATCGAG...

Protein

Download Protein FASTA

194 aa · TkA03G413660|TK1151|PROTEIN

MCPTDTSPHKTMFINGFPCKNPSNITTSDFKNMHLSHKGSTDTFLQSSVAIVTASEFPGLNTLGLSTGRTDLEVDGLVMPHTHPRSSEMIFVVKGVVIVGFIDTDSKLFQSVLREGDVFVFPKGLLHYCLNSGFEDALFYSVYNAQNPGAVDISNAMFGGEASEMVKMAMAKLVSLTRVEDVHADDYKNLKDEL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G413660`
TK1151 ID	TkA03G413660
OH-1004 ID	LXL04_009258
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 41.102 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G413660

Location Chr03:102877526-102878110 (-)

Description Similar to IPK2a: Inositol polyphosphate multikinase alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61750`	May play a role in plant defense.	No verified direct reference in this release
`At3g04200`	May play a role in plant defense.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0537350`	May play a role in plant defense.	No verified direct reference in this release
`Os02g0491800`	May play a role in plant defense.	No verified direct reference in this release
`Os03g0651800`	May play a role in plant defense.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009258 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009749 response to glucose Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010264 myo-inositol hexakisphosphate biosynthetic process Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0032958 inositol phosphate biosynthetic process Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT5G07370

ath:AT5G61750

ath:AT5G61760

dosa:Os02g0523800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.447

Rank 1 · TkA03G413660 · TK1151

Lysosome / Vacuole0.251

Rank 2 · TkA03G413660 · TK1151

Cytoplasm0.135

Rank 3 · TkA03G413660 · TK1151

Endoplasmic reticulum0.123

Rank 4 · TkA03G413660 · TK1151

Cell membrane0.061

Rank 5 · TkA03G413660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_144-158 aa

PF03079ARD70-128 aa

PF19480DUF601672-111 aa

PF07883Cupin_276-143 aa

PF02311AraC_binding80-132 aa

PF05899Cupin_386-125 aa

PF08007JmjC_2105-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G413660	`PF00190`	Cupin_1	44	158	9.6e-33	113.6
TkA03G413660	`PF03079`	ARD	70	128	0.22	12.4
TkA03G413660	`PF19480`	DUF6016	72	111	0.0017	18.6
TkA03G413660	`PF07883`	Cupin_2	76	143	3.9e-10	40.0
TkA03G413660	`PF02311`	AraC_binding	80	132	0.2	12.1
TkA03G413660	`PF05899`	Cupin_3	86	125	0.00043	20.6
TkA03G413660	`PF08007`	JmjC_2	105	143	0.029	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLT3`	Arabidopsis thaliana	sp\|Q9FLT3\|GL34_ARATH Germin-like protein subfamily 3 member 4	62.700%	Swiss-Prot	High
`Q9M8X6`	Arabidopsis thaliana	sp\|Q9M8X6\|GL16_ARATH Germin-like protein subfamily 1 member 6	39.900%	Swiss-Prot	Medium
`Q2R352`	Oryza sativa subsp. japonica	sp\|Q2R352\|GL111_ORYSJ Germin-like protein 11-1	51.100%	Swiss-Prot	High
`Q6K5P8`	Oryza sativa subsp. japonica	sp\|Q6K5P8\|GL23_ORYSJ Putative germin-like protein 2-3	40.600%	Swiss-Prot	Medium
`Q7XZY1`	Oryza sativa subsp. japonica	sp\|Q7XZY1\|GL32_ORYSJ Putative germin-like protein 3-2	43.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card