TkA03G409990 | RubberDandelionOmics

Gene overview

TkA03G409990

Reference: TK1151 Chr: Chr03 Coordinates: 101943664-101944161 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · TkA03G409990|TK1151|cDNA

ATGGTTTCTTCATGTTTCGTACCTCTGTTTCTTGCTCTTTTCATTTCTAGCACTCTTGTTGTCAATGGAGACATCGATTTGATCCAGAAAACCTGCAAATCCACCAAATTTTACGACCTCTGCATCTCGTCTCTCCAATCCGACTCAACCAGCCCGGAAGCCGACACAAAAGGGCTCGCACTTATAATGGCGAAAGTTGCGATGGCGAATGCCACCAACACCACCTCCTATTTATCATCGAACGTACTCATGATCAAGAA...

CDS

Download CDS FASTA

498 bp · TkA03G409990|TK1151|CDS

ATGGTTTCTTCATGTTTCGTACCTCTGTTTCTTGCTCTTTTCATTTCTAGCACTCTTGTTGTCAATGGAGACATCGATTTGATCCAGAAAACCTGCAAATCCACCAAATTTTACGACCTCTGCATCTCGTCTCTCCAATCCGACTCAACCAGCCCGGAAGCCGACACAAAAGGGCTCGCACTTATAATGGCGAAAGTTGCGATGGCGAATGCCACCAACACCACCTCCTATTTATCATCGAACGTACTCATGATCAAGAA...

Protein

Download Protein FASTA

165 aa · TkA03G409990|TK1151|PROTEIN

MVSSCFVPLFLALFISSTLVVNGDIDLIQKTCKSTKFYDLCISSLQSDSTSPEADTKGLALIMAKVAMANATNTTSYLSSNVLMIKNTDSFAKRALKQCADKYSAAGTALQNSVQDLSSELYDYAYMHVMAAADYANACRNGFMRYPRLVYPPEIAAREEGLKRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G409990`
TK1151 ID	TkA03G409990
OH-1004 ID	LXL04_009217
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G409990

Location Chr03:101943664-101944161 (+)

Description Similar to C/VIF2: Cell wall / vacuolar inhibitor of fructosidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64620`	Inhibits fructosidases from both cell wall (cell wall invertase CWI) and vacuoles (vacuolar invertase VI).	In Arabidopsis thaliana, the invertase inhibitors AtC/VIF1 and 2 exhibit distinct target enzyme specificities and expression profiles.2004 · DOI: 10.1016/j.febslet.2004.07.062

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009217 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0009846 pollen germination Biological Process

GO:0043086 negative regulation of catalytic activity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043667 pollen wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G47960

ath:AT5G64620

dosa:Os08g0108100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.579

Rank 1 · TkA03G409990 · TK1151

Endoplasmic reticulum0.129

Rank 2 · TkA03G409990 · TK1151

Cytoplasm0.115

Rank 3 · TkA03G409990 · TK1151

Lysosome / Vacuole0.096

Rank 4 · TkA03G409990 · TK1151

Cell membrane0.085

Rank 5 · TkA03G409990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28586DUF84401-112 aa

PF04043PMEI26-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G409990	`PF28586`	DUF8440	1	112	0.14	13.5
TkA03G409990	`PF04043`	PMEI	26	144	2.1e-23	83.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49603`	Arabidopsis thaliana	sp\|O49603\|CVIF2_ARATH Cell wall / vacuolar inhibitor of fructosidase 2	46.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card