TkA03G408870 | RubberDandelionOmics

Gene overview

TkA03G408870

Reference: TK1151 Chr: Chr03 Coordinates: 101627274-101637921 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

823 bp · TkA03G408870|TK1151|cDNA

CAAAAATCCCTAAATAAGCAAATTCCAAACAGCCCAATCAGTTATCAACTAACCATAATCGCAAAACAATCAATGATCAATGAACAGTTAGTAATACATTGTCACATAATAATAATTAAGGACATCATTAACGATTCTATGAACTTGGTGCGGTGCCACCTGAAATTGTATTCGTATCCATTTCACAAGTCTACCGGAGGAAACCATGAACGTGGCGCCTTCCCCTCCACCGCCTACCGGAGAAGATGATAATAGGAACA...

CDS

Download CDS FASTA

408 bp · TkA03G408870|TK1151|CDS

ATGAACGTGGCGCCTTCCCCTCCACCGCCTACCGGAGAAGATGATAATAGGAACAGTAGGACCTCCGCGAAAATTCCGCCGTCGTCACTCGATTCTCTACCAAGTAGTTCGCCCTCCTCCCCTATTCTCCGAGGTCCGATCAAATTAACGGCGAGATCATGCTTGTACGAGATATGCACGAAAAGTCACTGGAAACGTCCGGTATTCACTTGTTGCAGCGAAATAGGGCCGAGTAACCTCAGATCATTCACCTACAAAGC...

Protein

Download Protein FASTA

135 aa · TkA03G408870|TK1151|PROTEIN

MNVAPSPPPPTGEDDNRNSRTSAKIPPSSLDSLPSSSPSSPILRGPIKLTARSCLYEICTKSHWKRPVFTCCSEIGPSNLRSFTYKAVVEMIEGPKSNTVVECIGKPQSTKKNAADSAAEGVLWYLVHLGYPKKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G408870`
TK1151 ID	TkA03G408870
OH-1004 ID	LXL04_009204
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G408870

Location Chr03:101627274-101637921 (+)

Description Similar to DCL4: Endoribonuclease Dicer homolog 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0509300`	Involved in the RNA silencing pathway.	The small interfering RNA production pathway is required for shoot meristem initiation in rice.2007 · DOI: 10.1073/pnas.0704339104 Oryza sativa dicer-like4 reveals a key role for small interfering RNA silencing in plant development.2007 · DOI: 10.1105/tpc.107.052209

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009204 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006396 RNA processing Biological Process

GO:0009616 RNAi-mediated antiviral immune response Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0009908 flower development Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0010050 vegetative phase change Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010267 ta-siRNA processing Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

KEGG gene cross-reference

ath:AT1G01040

ath:AT1G80650

ath:AT5G20320

dosa:Os03g0121800

dosa:Os04g0509300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.804

Rank 1 · TkA03G408870 · TK1151

Cytoplasm0.296

Rank 2 · TkA03G408870 · TK1151

Cell membrane0.052

Rank 3 · TkA03G408870 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA03G408870 · TK1151

Plastid0.014

Rank 5 · TkA03G408870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14709DND1_DSRM50-126 aa

PF00035dsrm53-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G408870	`PF14709`	DND1_DSRM	50	126	7.5e-21	74.9
TkA03G408870	`PF00035`	dsrm	53	122	1.8e-05	25.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A7LFZ6`	Oryza sativa subsp. japonica	sp\|A7LFZ6\|DCL4_ORYSJ Endoribonuclease Dicer homolog 4	50.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card