TkA03G408580 | RubberDandelionOmics

Gene overview

TkA03G408580

Reference: TK1151 Chr: Chr03 Coordinates: 101537496-101541230 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1959 bp · TkA03G408580|TK1151|cDNA

ATGGGGCGTTACACCTTTCGCTTTTTCAACTCATGGCTTTTAGAGAGTTCGCTGACGGATGTAGTAAAAGCAGGGTGGACAATTGACTTTTCTTCAGGTAACTTTACCTCGCTTGCCTCCCTAGCAATTGTGGCTGGTAAACTCAAAAGCACAAAAGAGAACTTAAAGCAGTGGAGAGCCAAAGAAATGGAGGAAACAAAGAAACAAACAAAAGACATCACCGATAAGATGAATGAGATAGACCTGAAAGCAGAGGAAAC...

CDS

Download CDS FASTA

1959 bp · TkA03G408580|TK1151|CDS

ATGGGGCGTTACACCTTTCGCTTTTTCAACTCATGGCTTTTAGAGAGTTCGCTGACGGATGTAGTAAAAGCAGGGTGGACAATTGACTTTTCTTCAGGTAACTTTACCTCGCTTGCCTCCCTAGCAATTGTGGCTGGTAAACTCAAAAGCACAAAAGAGAACTTAAAGCAGTGGAGAGCCAAAGAAATGGAGGAAACAAAGAAACAAACAAAAGACATCACCGATAAGATGAATGAGATAGACCTGAAAGCAGAGGAAAC...

Protein

Download Protein FASTA

652 aa · TkA03G408580|TK1151|PROTEIN

MGRYTFRFFNSWLLESSLTDVVKAGWTIDFSSGNFTSLASLAIVAGKLKSTKENLKQWRAKEMEETKKQTKDITDKMNEIDLKAEETPLTEEEINSRRDLHLLLMELEAKRLQDLRQKARCKWALEGDENSGFFHGLINKNIRSQRLSGINFNGMWTTDPDKIKAEVLKHFTGKYKEPTQNRPEFRSSYLKQLSSIDSNSLEMPITYEEVKAVAWACGGERAPGPDGFTFEFIKKQWTIIGDDIFQANGVSGRETAISIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G408580`
TK1151 ID	TkA03G408580
OH-1004 ID	LXL04_026067
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.700
Protein coverage (%)	TK1151 43.865 / OH-1004 22.134 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G408580`
Location	Chr03:101537496-101541230 (-)
Description	Similar to Transposon TX1 uncharacterized 149 kDa protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026067` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0003723 RNA binding Molecular Function GO:0003824 catalytic activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545

Rank 1 · TkA03G408580 · TK1151

Nucleus0.345

Rank 2 · TkA03G408580 · TK1151

Cell membrane0.127

Rank 3 · TkA03G408580 · TK1151

Mitochondrion0.043

Rank 4 · TkA03G408580 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA03G408580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10373EST1_DNA_bind4-103 aa

PF20394DUF668837-89 aa

PF10373EST1_DNA_bind150-193 aa

PF10373EST1_DNA_bind382-413 aa

PF13966zf-RVT447-512 aa

PF10373EST1_DNA_bind563-628 aa

PF20394DUF6688567-632 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G408580	`PF10373`	EST1_DNA_bind	4	103	0.79	9.9
TkA03G408580	`PF20394`	DUF6688	37	89	0.19	12.1
TkA03G408580	`PF10373`	EST1_DNA_bind	150	193	0.79	9.9
TkA03G408580	`PF10373`	EST1_DNA_bind	382	413	0.79	9.9
TkA03G408580	`PF13966`	zf-RVT	447	512	3e-17	63.8
TkA03G408580	`PF10373`	EST1_DNA_bind	563	628	0.79	9.9
TkA03G408580	`PF20394`	DUF6688	567	632	0.19	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card