Gene Card
Gene overview
cDNA / CDS / Protein Sequences
306 bp · TkA03G405520|TK1151|cDNA
ATGTCACAACGGTGGAAGCCTACTCGTATATTCCAGCGAGCACCCCGGGTTCGAGCTCCTTTACAGGGCAAACCCAGCCCCCTATGGGGTTTCCAGGGAAAATTTCACCACACACAGGGCTTCGCGCGAAGGATTTACCCGAGCATAGATACTACTCGGCACCCCCACACCCCGTATGGGTTATTAAACCCGATACATCACACCTGCCAGGGTTCGAACTCTGGATCCCCACTTTGGAGGGCAGAAGCTCTAGCCAACTG...
306 bp · TkA03G405520|TK1151|CDS
ATGTCACAACGGTGGAAGCCTACTCGTATATTCCAGCGAGCACCCCGGGTTCGAGCTCCTTTACAGGGCAAACCCAGCCCCCTATGGGGTTTCCAGGGAAAATTTCACCACACACAGGGCTTCGCGCGAAGGATTTACCCGAGCATAGATACTACTCGGCACCCCCACACCCCGTATGGGTTATTAAACCCGATACATCACACCTGCCAGGGTTCGAACTCTGGATCCCCACTTTGGAGGGCAGAAGCTCTAGCCAACTG...
Protein
Download Protein FASTA101 aa · TkA03G405520|TK1151|PROTEIN
MSQRWKPTRIFQRAPRVRAPLQGKPSPLWGFQGKFHHTQGFARRIYPSIDTTRHPHTPYGLLNPIHHTCQGSNSGSPLWRAEALANWTSDHIQILELGFIL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G405520 |
|---|---|
| TK1151 ID | TkA03G405520 |
| OH-1004 ID | LXL04_013767 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 58.900 |
| Protein coverage (%) | TK1151 93.069 / OH-1004 14.308Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G405520 |
|---|---|
| Location | Chr03:100837619-100837924 (+) |
| Description | Similar to HSR4: Protein HYPER-SENSITIVITY-RELATED 4 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0006950 response to stress Biological Process GO:0009411 response to UV Biological Process GO:0009617 response to bacterium Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009651 response to salt stress Biological Process GO:0009863 salicylic acid mediated signaling pathway Biological Process GO:0012501 programmed cell death Biological Process GO:0005739 mitochondrion Cellular Component GO:0005740 mitochondrial envelope Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component |
| KEGG gene cross-reference | ath:AT2G18190 ath:AT2G18193 ath:AT3G50930 ath:AT3G50940 ath:AT5G17740 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.