TkA03G405130 | RubberDandelionOmics

Gene overview

TkA03G405130

Reference: TK1151 Chr: Chr03 Coordinates: 100737686-100740768 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · TkA03G405130|TK1151|cDNA

GTAATGTTAATTCTCGCTCATAAATAGCGCACACAGGATATGCTTAGATAAACTGAACACCGAGGAGGGAAGCGACCAACTGTTTCACTTTTTACTCGCCGTCCTCCGACACTTCTCGCCGGAAAATTACCGATTTGCAACGAGATGTTTGCAGAAGAAAATGGGTTACATGGAGACCCAAGGATAAAAGCCATTTCAGATGCCATAAGAGTCGTTCCTCACTTCCCTAAACCAGGGATAATGTTTCAAGATATAACAAC...

CDS

Download CDS FASTA

483 bp · TkA03G405130|TK1151|CDS

ATGTTTGCAGAAGAAAATGGGTTACATGGAGACCCAAGGATAAAAGCCATTTCAGATGCCATAAGAGTCGTTCCTCACTTCCCTAAACCAGGGATAATGTTTCAAGATATAACAACGCTGCTGTTAGATCAAAAGGCGTTCAAATACACCGTTGATATCTTTGTCGATCGTTACACAGACAAGAAAATTTCAGTTGTTGCTGGCGTGGAAGCTAGAGGATTTATATTTGGCCCTCCAATCGCATTGGCTATTGGTGCTAA...

Protein

Download Protein FASTA

160 aa · TkA03G405130|TK1151|PROTEIN

MFAEENGLHGDPRIKAISDAIRVVPHFPKPGIMFQDITTLLLDQKAFKYTVDIFVDRYTDKKISVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISESYVLEYGTDCLEMHVGAVQPGESVLIVDDLVATGGTLSAAIRLLERVGADVLNVHA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G405130`
TK1151 ID	TkA03G405130
OH-1004 ID	LXL04_009169
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 97.500 / OH-1004 80.412 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G405130

Location Chr03:100737686-100740768 (+)

Description Similar to APT5: Adenine phosphoribosyltransferase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11160`	Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.	No verified direct reference in this release
`At1g80050`	Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.	No verified direct reference in this release
`At1g27450`	Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.	No verified direct reference in this release
`At4g22570`	Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.	Adenine phosphoribosyltransferase isoforms of Arabidopsis and their potential contributions to adenine and cytokinin metabolism.2002 · DOI: 10.1034/j.1399-3054.2002.1150106.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009169 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006166 purine ribonucleoside salvage Biological Process

GO:0006168 adenine salvage Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009690 cytokinin metabolic process Biological Process

GO:0044209 AMP salvage Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G27450

ath:AT1G80050

ath:AT4G22570

ath:AT5G11160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.569

Rank 1 · TkA03G405130 · TK1151

Nucleus0.272

Rank 2 · TkA03G405130 · TK1151

Plastid0.150

Rank 3 · TkA03G405130 · TK1151

Mitochondrion0.085

Rank 4 · TkA03G405130 · TK1151

Endoplasmic reticulum0.081

Rank 5 · TkA03G405130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00156Pribosyltran59-155 aa

PF14681UPRTase125-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G405130	`PF00156`	Pribosyltran	59	155	5e-15	55.9
TkA03G405130	`PF14681`	UPRTase	125	158	0.0013	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFP0`	Arabidopsis thaliana	sp\|Q9LFP0\|APT5_ARATH Adenine phosphoribosyltransferase 5	79.500%	Swiss-Prot	High
`Q42563`	Arabidopsis thaliana	sp\|Q42563\|APT2_ARATH Adenine phosphoribosyltransferase 2	79.500%	Swiss-Prot	High
`P31166`	Arabidopsis thaliana	sp\|P31166\|APT1_ARATH Adenine phosphoribosyltransferase 1, chloroplastic	78.100%	Swiss-Prot	High
`Q9SUW2`	Arabidopsis thaliana	sp\|Q9SUW2\|APT3_ARATH Adenine phosphoribosyltransferase 3	76.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card