TkA03G404780 | RubberDandelionOmics

Gene overview

TkA03G404780

Reference: TK1151 Chr: Chr03 Coordinates: 100646533-100648808 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1750 bp · TkA03G404780|TK1151|cDNA

CCCACACACACCTCCCCTCCCCAACCCTGAAAAAGAAAGGCGAAAAGGGTATTGGAAGTCTGAAGGGTTGGTGAGTAGGAAGAAGACCGTGTTAAGCTTCACCTCCTTTCTCTCTCCAAAAATATGTTGGCTTCCCCTCACAAATTTAGCTGATTGCTTTACGTTTTAGAAGATTATTAACATCGAGTCATGAAAGAAGAATCTGACAGGGAGGACAGCACGTAACTAGGTTGCTCTCTGTTGAAGCAATCATTAAAAGG...

CDS

Download CDS FASTA

912 bp · TkA03G404780|TK1151|CDS

ATGGATTTTCGCTCCTTCTTTTGCTGCATAAGGGTTTCCGATCGGAAAGAGAAAGAGAAGAAACAATCAACATGGAGGATATTTTCATTGAAGGAATTACATGCTGCCACCAACAATTTCAATTACGACAACAAGCTTGGTGAAGGCGGATTTGGCAGCGTTTATTGGGGTCAACTATGGGACGGATCTCAAATTGCAGTAAAAAGATTAAAAGTCTATAGCAACAAAGCCGAAATGGAATTCGCTGTTGAAGTTGAGAT...

Protein

Download Protein FASTA

303 aa · TkA03G404780|TK1151|PROTEIN

MDFRSFFCCIRVSDRKEKEKKQSTWRIFSLKELHAATNNFNYDNKLGEGGFGSVYWGQLWDGSQIAVKRLKVYSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSEILLDWPRRMTIAIGSAEGIVYLHHQATPHIIHRDVKASNVLLDSEFKAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKLNSTTRRSITEWALPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G404780`
TK1151 ID	TkA03G404780
OH-1004 ID	LXL04_009165
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.010 / OH-1004 81.967 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G404780

Location Chr03:100646533-100648808 (+)

Description Similar to At3g15890: PTI1-like tyrosine-protein kinase At3g15890

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15890`	PTI1-like tyrosine-protein kinase At3g15890.	No verified direct reference in this release
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At1g68690`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0
`At3g24540`	Proline-rich receptor-like protein kinase PERK3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009165 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT1G68690

ath:AT1G70460

ath:AT3G15890

ath:AT4G33430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.677

Rank 1 · TkA03G404780 · TK1151

Cytoplasm0.273

Rank 2 · TkA03G404780 · TK1151

Nucleus0.184

Rank 3 · TkA03G404780 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA03G404780 · TK1151

Golgi apparatus0.032

Rank 5 · TkA03G404780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase41-251 aa

PF07714PK_Tyr_Ser-Thr42-249 aa

PF03109ABC146-71 aa

PF01636APH73-120 aa

PF03109ABC1152-192 aa

PF01636APH158-190 aa

PF17667Pkinase_fungal160-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G404780	`PF00069`	Pkinase	41	251	1e-40	140.5
TkA03G404780	`PF07714`	PK_Tyr_Ser-Thr	42	249	4.1e-42	145.0
TkA03G404780	`PF03109`	ABC1	46	71	0.0078	16.1
TkA03G404780	`PF01636`	APH	73	120	0.17	12.3
TkA03G404780	`PF03109`	ABC1	152	192	0.0078	16.1
TkA03G404780	`PF01636`	APH	158	190	0.17	12.3
TkA03G404780	`PF17667`	Pkinase_fungal	160	213	0.18	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSC2`	Arabidopsis thaliana	sp\|Q9LSC2\|Y3589_ARATH PTI1-like tyrosine-protein kinase At3g15890	68.700%	Swiss-Prot	High
`Q9CAL8`	Arabidopsis thaliana	sp\|Q9CAL8\|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13	50.400%	Swiss-Prot	High
`Q9SX31`	Arabidopsis thaliana	sp\|Q9SX31\|PERK9_ARATH Proline-rich receptor-like protein kinase PERK9	48.200%	Swiss-Prot	Medium
`Q9ZUE0`	Arabidopsis thaliana	sp\|Q9ZUE0\|PEK12_ARATH Proline-rich receptor-like protein kinase PERK12	48.200%	Swiss-Prot	Medium
`Q1PEM5`	Arabidopsis thaliana	sp\|Q1PEM5\|PERK3_ARATH Proline-rich receptor-like protein kinase PERK3	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card