TkA03G401180 | RubberDandelionOmics

Gene overview

TkA03G401180

Reference: TK1151 Chr: Chr03 Coordinates: 99794465-99795778 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1149 bp · TkA03G401180|TK1151|cDNA

CTAAAGTTTTGGGAACAGTGAATGTCATTTCAGTATTTCACGATCAACGTGGTAGGTAGGTTGAATTGGATTTTGTATAAATGCACGGACTGTTGTTAGTTGAGATTGAGGCCAAGATGATGATGAAAGCTGTGTGTTTGGTTATGCTATTTGCCTTTATCTCCAAATCATCATCACAAACAAATTCAATCGTCCAAAATCCGCAACCTAACCCTAACTTCAAGGTCAACTCTACTAATCAACTGAATGCTCAAACCTGT...

CDS

Download CDS FASTA

600 bp · TkA03G401180|TK1151|CDS

ATGCACGGACTGTTGTTAGTTGAGATTGAGGCCAAGATGATGATGAAAGCTGTGTGTTTGGTTATGCTATTTGCCTTTATCTCCAAATCATCATCACAAACAAATTCAATCGTCCAAAATCCGCAACCTAACCCTAACTTCAAGGTCAACTCTACTAATCAACTGAATGCTCAAACCTGTTCATTCACTGTCGATATCACGACGAGCTGTTCTTCCGTTAAATACACTCGAGATCAAATCAGCATCTCATTTGGCGATGC...

Protein

Download Protein FASTA

199 aa · TkA03G401180|TK1151|PROTEIN

MHGLLLVEIEAKMMMKAVCLVMLFAFISKSSSQTNSIVQNPQPNPNFKVNSTNQLNAQTCSFTVDITTSCSSVKYTRDQISISFGDAYGNQVYAPRIDDPSTKTFEQCSGDTFQIYGPCTYQICYLYLYRSGYDGWKPEYVDVYGYNTKAVSFYYDVWVPADTWYGFDYCSGYSASSHNQIGLTTILSCLVFYIYVIFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G401180`
TK1151 ID	TkA03G401180
OH-1004 ID	LXL04_009148
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G401180

Location Chr03:99794465-99795778 (-)

Description Similar to ATS3B: Embryo-specific protein ATS3B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62200`	May play a role during embryo development.	No verified direct reference in this release
`At2g41475`	May play a role during embryo development.	No verified direct reference in this release
`At5g07190`	May play a role during embryo development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009148 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G41475

ath:AT5G07190

ath:AT5G62200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.359

Rank 1 · TkA03G401180 · TK1151

Cell membrane0.262

Rank 2 · TkA03G401180 · TK1151

Endoplasmic reticulum0.127

Rank 3 · TkA03G401180 · TK1151

Cytoplasm0.125

Rank 4 · TkA03G401180 · TK1151

Lysosome / Vacuole0.108

Rank 5 · TkA03G401180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02144Rad18-66 aa

PF01477PLAT32-57 aa

PF06232ATS350-170 aa

PF01477PLAT63-160 aa

PF02144Rad1174-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G401180	`PF02144`	Rad1	8	66	0.023	14.5
TkA03G401180	`PF01477`	PLAT	32	57	0.00022	22.6
TkA03G401180	`PF06232`	ATS3	50	170	5.6e-50	169.1
TkA03G401180	`PF01477`	PLAT	63	160	0.00022	22.6
TkA03G401180	`PF02144`	Rad1	174	193	0.023	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPM5`	Arabidopsis thaliana	sp\|Q6NPM5\|ATS3B_ARATH Embryo-specific protein ATS3B	57.500%	Swiss-Prot	High
`Q681K2`	Arabidopsis thaliana	sp\|Q681K2\|ATS3A_ARATH Embryo-specific protein ATS3A	51.500%	Swiss-Prot	High
`Q9LYP6`	Arabidopsis thaliana	sp\|Q9LYP6\|ATS3_ARATH Embryo-specific protein ATS3	45.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card