TkA03G400900 | RubberDandelionOmics

Gene overview

TkA03G400900

Reference: TK1151 Chr: Chr03 Coordinates: 99703147-99705493 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1629 bp · TkA03G400900|TK1151|cDNA

TTTTAATCACTGTCACTGAACGTTTTAGGTATGATTTTTTCAATTTCCATTCACAAAAACGACTCGGATGATAATAACAGTGGTAGATTTAGATTTGATCTAAATGTAGACTTCCATATCGTCTCTCTCATCTCAACCACCCTGTCGGCATTTGGGATTTTGTCAATATAATTCGTGATACAAAAGATACCATATGCAATACAATTACAATATATTATAACCAAGAAACTCCCTCTCTCTTCTCTCTTCTCTCTCCGTCT...

CDS

Download CDS FASTA

1233 bp · TkA03G400900|TK1151|CDS

ATGGGGATAGATCCGAGGCAGATCGTCGCGGGGGTGCTTACAGTCACCATGTTTGTAATGCTAGGTAACATGATTAAGCGCGACCACTTTGATGCCCCCATTTCTCATGTGAACCACGCCGGGTCGACTCAACGTTTTGACGACAATAATGATTCGGAACAGAGCTTTGCACTTGGCAATGGTGGCGATGGTCCATGGAAGGAGGAATCCGGTGGACTTAAGCGTTGTTGGTCTAAGCCAGACCTCGACGAATCAGAAGA...

Protein

Download Protein FASTA

411 aa · TkA03G400900|TK1151|PROTEIN

MGIDPRQIVAGVLTVTMFVMLGNMIKRDHFDAPISHVNHAGSTQRFDDNNDSEQSFALGNGGDGPWKEESGGLKRCWSKPDLDESEESKGFVTFSLTNGPEYHVSQIADAVVVARYLKASLVVPDIRGSEPGDWRNFGDIYDIEKFVNSLDGVVKVVKTQPSEISSKNLAVLRVPNRVTEDYISENIEPAFRTKGNVRLATYFPSVNMKKSKLQQDNSIGCLATYGTLELQPDVQEVVDSMVDRLKTLSRKSDGQFVAVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G400900`
TK1151 ID	TkA03G400900
OH-1004 ID	LXL04_002961
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.000
Protein coverage (%)	TK1151 76.886 / OH-1004 60.345 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G400900

Location Chr03:99703147-99705493 (+)

Description Similar to MSR1: Protein MANNAN SYNTHESIS-RELATED 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51630`	Glycosyltransferase involved in mannan biosynthesis.	Identification of an additional protein involved in mannan biosynthesis.2013 · DOI: 10.1111/tpj.12019
`At3g21190`	Glycosyltransferase involved in mannan biosynthesis.	Identification of an additional protein involved in mannan biosynthesis.2013 · DOI: 10.1111/tpj.12019
`At1g38065`	O-fucosyltransferase 10.	No verified direct reference in this release
`At1g38131`	O-fucosyltransferase 11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002961 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0046354 mannan biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G38065

ath:AT1G38131

ath:AT1G51630

ath:AT3G21190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.805

Rank 1 · TkA03G400900 · TK1151

Endoplasmic reticulum0.062

Rank 2 · TkA03G400900 · TK1151

Cell membrane0.061

Rank 3 · TkA03G400900 · TK1151

Extracellular0.052

Rank 4 · TkA03G400900 · TK1151

Cytoplasm0.042

Rank 5 · TkA03G400900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250O-FucT105-374 aa

PF16180RelB_leu_zip161-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G400900	`PF10250`	O-FucT	105	374	2.3e-33	117.0
TkA03G400900	`PF16180`	RelB_leu_zip	161	186	0.14	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPA5`	Arabidopsis thaliana	sp\|Q0WPA5\|MSR2_ARATH Protein MANNAN SYNTHESIS-RELATED 2	58.700%	Swiss-Prot	High
`Q9LU40`	Arabidopsis thaliana	sp\|Q9LU40\|MSR1_ARATH Protein MANNAN SYNTHESIS-RELATED 1	57.500%	Swiss-Prot	High
`Q8LNP3`	Arabidopsis thaliana	sp\|Q8LNP3\|OFT10_ARATH O-fucosyltransferase 10	27.000%	Swiss-Prot	Low
`Q8GUM0`	Arabidopsis thaliana	sp\|Q8GUM0\|OFT11_ARATH O-fucosyltransferase 11	27.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card