TkA03G398280 | RubberDandelionOmics

Gene overview

TkA03G398280

Reference: TK1151 Chr: Chr03 Coordinates: 98996537-98997538 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA03G398280|TK1151|cDNA

ATGAAATCAGTAGATGCTATCATCAACGATTCCATTTCCGTCTCCTCATCGGATCCCTACCCCTTCTCTTCATCGGCGACCAGGGCTCAGCGGACATGGGAGCTCGCTCCGGTGGCACCATCGATGGCGATGCTATCATTCTCTGGGAGCTCGCTTGATGATCGGATCTTAAGCAAAATGGGTGAAGGTACATTTGGGCAAGTTTTGGAGTGTTTGGACAATGAGAAGAAAGATCCTGTAGCCATTAAAATTGTCCAGAC...

CDS

Download CDS FASTA

372 bp · TkA03G398280|TK1151|CDS

ATGAAATCAGTAGATGCTATCATCAACGATTCCATTTCCGTCTCCTCATCGGATCCCTACCCCTTCTCTTCATCGGCGACCAGGGCTCAGCGGACATGGGAGCTCGCTCCGGTGGCACCATCGATGGCGATGCTATCATTCTCTGGGAGCTCGCTTGATGATCGGATCTTAAGCAAAATGGGTGAAGGTACATTTGGGCAAGTTTTGGAGTGTTTGGACAATGAGAAGAAAGATCCTGTAGCCATTAAAATTGTCCAGAC...

Protein

Download Protein FASTA

123 aa · TkA03G398280|TK1151|PROTEIN

MKSVDAIINDSISVSSSDPYPFSSSATRAQRTWELAPVAPSMAMLSFSGSSLDDRILSKMGEGTFGQVLECLDNEKKDPVAIKIVQTCHTPKSVGGNIRGQNFMSISQPQHNSVDIATILKIH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G398280`
TK1151 ID	TkA03G398280
OH-1004 ID	LXL04_037973
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 70.732 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G398280

Location Chr03:98996537-98997538 (+)

Description Similar to AFC1: Serine/threonine-protein kinase AFC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53570`	Activator of yeast transcription factor, STE12.	No verified direct reference in this release
`At4g24740`	Serine/threonine-protein kinase AFC2.	No verified direct reference in this release
`At4g32660`	Serine/threonine-protein kinase AFC3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037973 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004712 protein serine/threonine/tyrosine kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G53570

ath:AT4G24740

ath:AT4G32660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.431

Rank 1 · TkA03G398280 · TK1151

Nucleus0.429

Rank 2 · TkA03G398280 · TK1151

Mitochondrion0.113

Rank 3 · TkA03G398280 · TK1151

Cell membrane0.101

Rank 4 · TkA03G398280 · TK1151

Endoplasmic reticulum0.073

Rank 5 · TkA03G398280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase57-92 aa

PF07714PK_Tyr_Ser-Thr57-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G398280	`PF00069`	Pkinase	57	92	4.3e-05	23.8
TkA03G398280	`PF07714`	PK_Tyr_Ser-Thr	57	105	0.0046	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P51566`	Arabidopsis thaliana	sp\|P51566\|AFC1_ARATH Serine/threonine-protein kinase AFC1	63.400%	Swiss-Prot	Low
`P51567`	Arabidopsis thaliana	sp\|P51567\|AFC2_ARATH Serine/threonine-protein kinase AFC2	71.900%	Swiss-Prot	Low
`P51568`	Arabidopsis thaliana	sp\|P51568\|AFC3_ARATH Serine/threonine-protein kinase AFC3	35.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card