TkA03G397000 | RubberDandelionOmics

Gene overview

TkA03G397000

Reference: TK1151 Chr: Chr03 Coordinates: 98652386-98652838 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

453 bp · TkA03G397000|TK1151|cDNA

TTGTATTTCCGAAATCTTATATCTAACAGCTACAGCTTTTCCGACCACTTTTTACACCACCATGGCCCACAAGGTACTTTTCCTTTTCTTGATAGTGAATGCGAAACCTACCCCATTACCGACTTCACGGGTATATCTTTATCTCCCCAGCTATTCGCCACCCACTTCCCTCGAACCCTTTTACTGCCGTGTGTGACTTCGTGCAAATTTGTGTATCTTTGTCGGGAGCTGAAAGATGTTTTGGTTTCGAAATGGTTGTT...

CDS

Download CDS FASTA

453 bp · TkA03G397000|TK1151|CDS

TTGTATTTCCGAAATCTTATATCTAACAGCTACAGCTTTTCCGACCACTTTTTACACCACCATGGCCCACAAGGTACTTTTCCTTTTCTTGATAGTGAATGCGAAACCTACCCCATTACCGACTTCACGGGTATATCTTTATCTCCCCAGCTATTCGCCACCCACTTCCCTCGAACCCTTTTACTGCCGTGTGTGACTTCGTGCAAATTTGTGTATCTTTGTCGGGAGCTGAAAGATGTTTTGGTTTCGAAATGGTTGTT...

Protein

Download Protein FASTA

150 aa · TkA03G397000|TK1151|PROTEIN

LYFRNLISNSYSFSDHFLHHHGPQGTFPFLDSECETYPITDFTGISLSPQLFATHFPRTLLLPCVTSCKFVYLCRELKDVLVSKWLFMSKLREKDLPPLELNEAFDLFCRGILDYGPFWEHVSGGVLNKFGYKQVYDSEVLYFYRIWVFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G397000`
TK1151 ID	TkA03G397000
OH-1004 ID	LXL04_031474
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.500
Protein coverage (%)	TK1151 81.333 / OH-1004 35.207 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G397000

Location Chr03:98652386-98652838 (+)

Description Similar to SOT16: Cytosolic sulfotransferase 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07010`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of hydroxyjasmonates, with a preference for 12- hydroxyjasmonate over 11-hydroxyjasmonate.	Biochemical and molecular characterization of a hydroxyjasmonate sulfotransferase from Arabidopsis thaliana.2003 · DOI: 10.1074/jbc.m211943200
`At1g28170`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At5g07000`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At5g43690`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At3g45070`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of flavones and flavonols.	Biochemical and molecular characterization of flavonoid 7-sulfotransferase from Arabidopsis thaliana.2006 · DOI: 10.1016/j.plaphy.2006.10.004

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031474 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009806 lignan metabolic process Biological Process

GO:0009812 flavonoid metabolic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0032260 response to jasmonic acid stimulus involved in jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0051923 sulfation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008146 sulfotransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G74100

ath:AT3G45070

ath:AT3G45080

ath:AT5G07010

ath:AT5G43690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.657

Rank 1 · TkA03G397000 · TK1151

Nucleus0.234

Rank 2 · TkA03G397000 · TK1151

Endoplasmic reticulum0.150

Rank 3 · TkA03G397000 · TK1151

Peroxisome0.043

Rank 4 · TkA03G397000 · TK1151

Mitochondrion0.038

Rank 5 · TkA03G397000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26105RAG1_C8-20 aa

PF00685Sulfotransfer_148-125 aa

PF26105RAG1_C74-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G397000	`PF26105`	RAG1_C	8	20	0.057	13.9
TkA03G397000	`PF00685`	Sulfotransfer_1	48	125	5.5e-15	56.2
TkA03G397000	`PF26105`	RAG1_C	74	91	0.057	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L5A7`	Arabidopsis thaliana	sp\|Q8L5A7\|SOT15_ARATH Cytosolic sulfotransferase 15	35.300%	Swiss-Prot	Medium
`Q9FZ91`	Arabidopsis thaliana	sp\|Q9FZ91\|SOT7_ARATH Cytosolic sulfotransferase 7	41.700%	Swiss-Prot	Medium
`Q8GZ53`	Arabidopsis thaliana	sp\|Q8GZ53\|SOT14_ARATH Cytosolic sulfotransferase 14	39.500%	Swiss-Prot	Medium
`Q9FG94`	Arabidopsis thaliana	sp\|Q9FG94\|SOT1_ARATH Cytosolic sulfotransferase 1	39.800%	Swiss-Prot	Medium
`Q9M1V2`	Arabidopsis thaliana	sp\|Q9M1V2\|SOT5_ARATH Cytosolic sulfotransferase 5	36.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card