TkA03G394270 | RubberDandelionOmics

Gene overview

TkA03G394270

Reference: TK1151 Chr: Chr03 Coordinates: 97898437-97908788 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3489 bp · TkA03G394270|TK1151|cDNA

CTAGGGTTTAAAGGCTACTCATCAAAACCCTCACAAAGCAGATGGTTCACTAGTGTTTGTTAGCTGAGAAATCTGTAACGGCTACAATGAATGTCGATATGGATACGTCTCCTAGTTATTTTGATCCTCAAGACTTAAGCCACAGAGAGCGTTACCGGCGTTACGGAAAAAGGTTTTCGCCTTCACCTAACCAAGAGAGTTATCAATCGAAGTTCAGTAATGCTGCTCTGTATCTTGAAAATATCAAAAAAGAAGTTGAC...

CDS

Download CDS FASTA

3804 bp · TkA03G394270|TK1151|CDS

ATGGATACGTCTCCTAGTTATTTTGATCCTCAAGACTTAAGCCACAGAGAGCGTTACCGGCGTTACGGAAAAAGGTTTTCGCCTTCACCTAACCAAGAGAGTTATCAATCGAAGTTCAGTAATGCTGCTCTGTATCTTGAAAATATCAAAAAAGAAGTTGACCATTCTGATGGCGATCAATCAGAAGGAATAAACGCGAGAACTCAATCTTCTTTCAAAAGAAGATCGCCATCAATAGACAATCGTGGAATAGCTGAAAT...

Protein

Download Protein FASTA

1267 aa · TkA03G394270|TK1151|PROTEIN

MDTSPSYFDPQDLSHRERYRRYGKRFSPSPNQESYQSKFSNAALYLENIKKEVDHSDGDQSEGINARTQSSFKRRSPSIDNRGIAEMGIADDSAGRSRTHSLKACKHEDDASPDSGDATYPLFASLFDSALQGLMSIPDLILRLEGACRNVSESIKLIIIIFFFYSNSCSERHRIVEDKLMRQKAKMLLDEAASWSLLWYLYGKGNEELPEDLILVPTTSHLEACQFVAADHKAQLCLRLIQWLEGLASKALDLEYKVRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G394270`
TK1151 ID	TkA03G394270
OH-1004 ID	LXL04_009039
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 98.967 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G394270

Location Chr03:97898437-97908788 (+)

Description Similar to NUP107: Nuclear pore complex protein NUP107

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14120`	Nuclear pore complex protein NUP107.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009039 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000054 ribosomal subunit export from nucleus Biological Process

GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0016973 poly(A)+ mRNA export from nucleus Biological Process

GO:0051292 nuclear pore complex assembly Biological Process

GO:0000776 kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005643 nuclear pore Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G14120

hsa:57122

mmu:103468

spo:3361255

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.739

Rank 1 · TkA03G394270 · TK1151

Cytoplasm0.253

Rank 2 · TkA03G394270 · TK1151

Cell membrane0.060

Rank 3 · TkA03G394270 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA03G394270 · TK1151

Mitochondrion0.038

Rank 5 · TkA03G394270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07607DUF15705-23 aa

PF07607DUF1570170-210 aa

PF04121Nup84_Nup100188-852 aa

PF07607DUF1570591-607 aa

PF04121Nup84_Nup100992-1048 aa

PF03108DBD_Tnp_Mut1107-1171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G394270	`PF07607`	DUF1570	5	23	0.27	12.3
TkA03G394270	`PF07607`	DUF1570	170	210	0.27	12.3
TkA03G394270	`PF04121`	Nup84_Nup100	188	852	1.2e-68	232.7
TkA03G394270	`PF07607`	DUF1570	591	607	0.27	12.3
TkA03G394270	`PF04121`	Nup84_Nup100	992	1048	1.2e-68	232.7
TkA03G394270	`PF03108`	DBD_Tnp_Mut	1107	1171	0.00097	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L748`	Arabidopsis thaliana	sp\|Q8L748\|NU107_ARATH Nuclear pore complex protein NUP107	63.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card