TkA03G392260 | RubberDandelionOmics

Gene overview

TkA03G392260

Reference: TK1151 Chr: Chr03 Coordinates: 97256227-97256867 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA03G392260|TK1151|cDNA

GAGGAAGAAGCGAATAGGTCAATATACTCTGTTTCTACAAAGTATTACTATGCGTTTGGCTGCAAAATCGACGTCAATGTTGTTCATCGTATCAAATCTATGCCCACTGTAAGATGGGTTTTGCCGGATTCTCATCTCTGTCATGGTACCAATGATTACGGAGGAGAACCATTTATTAATGGAAATGTTGTTCTCTATGATGAGAAGTTCCATGAGGACTGGCTACAAGATCAAAACGACAATGGATTTAGGCGGAGAAG...

CDS

Download CDS FASTA

306 bp · TkA03G392260|TK1151|CDS

GAGGAAGAAGCGAATAGGTCAATATACTCTGTTTCTACAAAGTATTACTATGCGTTTGGCTGCAAAATCGACGTCAATGTTGTTCATCGTATCAAATCTATGCCCACTGTAAGATGGGTTTTGCCGGATTCTCATCTCTGTCATGGTACCAATGATTACGGAGGAGAACCATTTATTAATGGAAATGTTGTTCTCTATGATGAGAAGTTCCATGAGGACTGGCTACAAGATCAAAACGACAATGGATTTAGGCGGAGAAG...

Protein

Download Protein FASTA

101 aa · TkA03G392260|TK1151|PROTEIN

EEEANRSIYSVSTKYYYAFGCKIDVNVVHRIKSMPTVRWVLPDSHLCHGTNDYGGEPFINGNVVLYDEKFHEDWLQDQNDNGFRRRRRRRSRRKEQKIDSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G392260`
TK1151 ID	TkA03G392260
OH-1004 ID	LXL04_009007
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 52.332 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G392260

Location Chr03:97256227-97256867 (+)

Description Similar to MORF7: Multiple organellar RNA editing factor 7, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72530`	Involved in organellar RNA editing.	Comprehensive high-resolution analysis of the role of an Arabidopsis gene family in RNA editing.2013 · DOI: 10.1371/journal.pgen.1003584
`At1g11430`	Involved in organellar RNA editing.	No verified direct reference in this release
`At3g06790`	Involved in organellar RNA editing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009007 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002103 endonucleolytic cleavage of tetracistronic rRNA transcript (SSU-rRNA, LSU-rRNA, 4.5S-rRNA, 5S-rRNA) Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0009657 plastid organization Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:1900865 chloroplast RNA modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G11430

ath:AT1G32580

ath:AT1G72530

ath:AT3G15000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.391

Rank 1 · TkA03G392260 · TK1151

Cytoplasm0.329

Rank 2 · TkA03G392260 · TK1151

Endoplasmic reticulum0.148

Rank 3 · TkA03G392260 · TK1151

Lysosome / Vacuole0.109

Rank 4 · TkA03G392260 · TK1151

Cell membrane0.086

Rank 5 · TkA03G392260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21864MORF_dom1-58 aa

PF01807Zn_ribbon_DnaG10-41 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G392260	`PF21864`	MORF_dom	1	58	1.2e-17	64.3
TkA03G392260	`PF01807`	Zn_ribbon_DnaG	10	41	0.25	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAH0`	Arabidopsis thaliana	sp\|Q9CAH0\|MORF7_ARATH Multiple organellar RNA editing factor 7, mitochondrial	66.300%	Swiss-Prot	High
`Q9LPZ1`	Arabidopsis thaliana	sp\|Q9LPZ1\|MORF9_ARATH Multiple organellar RNA editing factor 9, chloroplastic	42.900%	Swiss-Prot	Medium
`Q84JZ6`	Arabidopsis thaliana	sp\|Q84JZ6\|MORF3_ARATH Multiple organellar RNA editing factor 3, mitochondrial	45.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card