TkA03G388980 | RubberDandelionOmics

Gene overview

TkA03G388980

Reference: TK1151 Chr: Chr03 Coordinates: 96343583-96348669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3380 bp · TkA03G388980|TK1151|cDNA

CAGAAACACACACTAGGACAGCCTTCTCTCTCACTCTATGTTTCTCTCTCTATTTCGCGGAAACCTAAAGTGGTGACGACTAGGGTTTTCGGGAGTTTCGCCCTCGAATTACTCACAAACGGCTTCAAATCTTGATTCATAAACATGAACAGCAATGATGAAAGAGGCATTGTACCAGTAGATGTCCAAGGGAACAATGCTTCTTCTGTACCAAACTCCAGCAGTTCAACCATTAAGATCGACTCATTATGTATCAAACT...

CDS

Download CDS FASTA

2886 bp · TkA03G388980|TK1151|CDS

ATGAACAGCAATGATGAAAGAGGCATTGTACCAGTAGATGTCCAAGGGAACAATGCTTCTTCTGTACCAAACTCCAGCAGTTCAACCATTAAGATCGACTCATTATGTATCAAACTTGGTTTTGTCAAGGAGAAGGATGATGCTGCAGAAAAATGTAGCCATTTTTCTATACGAGGTTATGTTTCTGGGATGCGTGAAAGAGGAAGCAGCAACTTCCTACCTTTTCCTGAAGAACTTCCTCCTATGGATGTCCCCAATTT...

Protein

Download Protein FASTA

961 aa · TkA03G388980|TK1151|PROTEIN

MNSNDERGIVPVDVQGNNASSVPNSSSSTIKIDSLCIKLGFVKEKDDAAEKCSHFSIRGYVSGMRERGSSNFLPFPEELPPMDVPNFKYWLCQSCLRNCGNASTSHQTDQVVSVCDQSMILPCARSFPPNICGKVAPMLPFGEGTSGVKPVDDSSDDDDDERVHPAFGLNESQIHADTVPQEPITFGGIDTNFGSKANAGRTLSNDGRDNELKDSHVMKETITTGPLGPTVQSSQQDDHPNGHTRRKTRKVRLLKELLGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G388980`
TK1151 ID	TkA03G388980
OH-1004 ID	LXL04_008272
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G388980

Location Chr03:96343583-96348669 (-)

Description Similar to EMF1: Protein EMBRYONIC FLOWER 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11530`	Transcription repressor that regulates phase transition during shoot, flower and seeds development.	Genetic interactions of the Arabidopsis flowering time gene FCA, with genes regulating floral initiation.1999 · DOI: 10.1046/j.1365-313x.1999.00364.x EMF1, a novel protein involved in the control of shoot architecture and flowering in Arabidopsis.2001 · DOI: 10.1105/tpc.010094 EMF genes maintain vegetative development by repressing the flower program in Arabidopsis.2003 · DOI: 10.1105/tpc.007831 EMBRYONIC FLOWER1 participates in polycomb group-mediated AG gene silencing in Arabidopsis.2008 · DOI: 10.1105/tpc.106.049957 Epigenetic regulation of gene programs by EMF1 and EMF2 in Arabidopsis.2010 · DOI: 10.1104/pp.109.143495 Temporal and spatial requirement of EMF1 activity for Arabidopsis vegetative and reproductive development.2009 · DOI: 10.1093/mp/ssp004 EMBRYONIC FLOWER1 and ULTRAPETALA1 Act Antagonistically on Arabidopsis Development and Stress Response.2013 · DOI: 10.1104/pp.112.213223 Genetic regulation of shoot development in Arabidopsis: role of the EMF genes.1995 · DOI: 10.1006/dbio.1995.1158 EMF genes regulate Arabidopsis inflorescence development.1997 · DOI: 10.1105/tpc.9.11.2011 EMF genes interact with late-flowering genes to regulate Arabidopsis shoot development.1998 · DOI: 10.1093/oxfordjournals.pcp.a029381 FLD interacts with genes that affect different developmental phase transitions to regulate Arabidopsis shoot development.1998 · DOI: 10.1046/j.1365-313x.1998.00204.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008272 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009791 post-embryonic development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010022 meristem determinacy Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048367 shoot system development Biological Process

GO:1901000 regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G11530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA03G388980 · TK1151

Cytoplasm0.088

Rank 2 · TkA03G388980 · TK1151

Cell membrane0.034

Rank 3 · TkA03G388980 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA03G388980 · TK1151

Plastid0.011

Rank 5 · TkA03G388980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28218EMF128-118 aa

PF28218EMF1196-954 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G388980	`PF28218`	EMF1	28	118	2.9e-125	421.0
TkA03G388980	`PF28218`	EMF1	196	954	2.9e-125	421.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYD9`	Arabidopsis thaliana	sp\|Q9LYD9\|EMF1_ARATH Protein EMBRYONIC FLOWER 1	39.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card