TkA03G385520 | RubberDandelionOmics

Gene overview

TkA03G385520

Reference: TK1151 Chr: Chr03 Coordinates: 95387965-95393722 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2553 bp · TkA03G385520|TK1151|cDNA

TGACATTTGACTTTTTAGGGCAACTGAAATATCATGTGGTTTTGGTGCAAGCAAACCCATTCATCTTTCTCCAGTTTTCAGTTTTCACATATCCCCATTTCTTTCTACTTCTTTTACTACTATCCATATTCTTCTGCTACTTCGTCTTTCTCTTTTCAACTCTGTTTCCCTGTAAAACCCCACTTTCCTCCCTACCCAATAATTTAGTTCACAACAATAACTTACCCTCTTTCTTTCCGTACATTATCTAGGGTTCATGT...

CDS

Download CDS FASTA

1884 bp · TkA03G385520|TK1151|CDS

ATGTTGCTTCCAGTTGTCGGCCTAGAGATGAATTCATCAATGGATGACATCAGCATGATACAACAACGCCATCATCTCGTGGTCCGTGAACTCGGTGGTGAAATCGATTTAGAAATCGGGCCCCACGAATTAATTACGGTTCCGCCCCAAGAATCTTCAGCAGACGACCATGAAGAAAACAAGAACATGGGGGCAATTGTGTCCCACTCCCACCTTCCAAGTGATGATCAAGAACTATTAAAGTCACTTCCAGCTAAAAG...

Protein

Download Protein FASTA

627 aa · TkA03G385520|TK1151|PROTEIN

MLLPVVGLEMNSSMDDISMIQQRHHLVVRELGGEIDLEIGPHELITVPPQESSADDHEENKNMGAIVSHSHLPSDDQELLKSLPAKRKKKVVKRWREEWADTYKWAYVDAKEGTTRIFCSICREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKSAGSIVEAALKRDPNELEFIQSVQEVIHALERVISKNSGYVNTMERLLEPERTIIFRVPWVDDRGEMHVNRGFRVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G385520`
TK1151 ID	TkA03G385520
OH-1004 ID	LXL04_008322
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G385520`
Location	Chr03:95387965-95393722 (-)
Description	Similar to NADP-specific glutamate dehydrogenase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008322` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006537 glutamate biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004352 glutamate dehydrogenase (NAD+) activity Molecular Function GO:0004354 glutamate dehydrogenase (NADP+) activity Molecular Function
KEGG gene cross-reference	bth:BT_1970 cef:CE1982 cgb:cg2280 cgl:Cgl2079 stm:STM1299 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.576

Rank 1 · TkA03G385520 · TK1151

Nucleus0.391

Rank 2 · TkA03G385520 · TK1151

Mitochondrion0.096

Rank 3 · TkA03G385520 · TK1151

Cell membrane0.063

Rank 4 · TkA03G385520 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA03G385520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25431zf-C17orf113103-166 aa

PF02812ELFV_dehydrog_N234-361 aa

PF00208ELFV_dehydrog380-625 aa

PF13241NAD_binding_7406-442 aa

PF13241NAD_binding_7554-580 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G385520	`PF25431`	zf-C17orf113	103	166	2.8e-25	88.6
TkA03G385520	`PF02812`	ELFV_dehydrog_N	234	361	6.3e-44	149.5
TkA03G385520	`PF00208`	ELFV_dehydrog	380	625	7.8e-61	206.6
TkA03G385520	`PF13241`	NAD_binding_7	406	442	0.038	15.3
TkA03G385520	`PF13241`	NAD_binding_7	554	580	0.038	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card