TkA03G381240 | RubberDandelionOmics

Gene overview

TkA03G381240

Reference: TK1151 Chr: Chr03 Coordinates: 94027953-94029499 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1204 bp · TkA03G381240|TK1151|cDNA

AAAGGAAATACAGGCACATCGAAAGAGGAAAACCTCATCAAAGAAGAAAGGTTGTCCTGCTCTTGTTACATTGAAGCGTTGTGATCCTAATTCAAATGATTTTTTGTATCCAAGTTTTTTGAACAGCATAACCACTGCTTAGTTTCAAAGCAAAATCACCATCTGTTACGTGTGAACAGGCAACTTGATATTGTTGAACAGTCTCTTATTCACACATTTGGATCATATAACATAGGTGCCACAAGAGCTTTTACCCTATT...

CDS

Download CDS FASTA

501 bp · TkA03G381240|TK1151|CDS

ATGCTTATTAGCAGAATGGAAGACAGGGTTAAATATGTGCCAAATTTCTTCTTTGATCATAAGATTGAAAACGGTTATCTTACGGGCGTCTTTTGGGCTGATGAGGCATCAAGAAGCAACTACAAAGAGTTTGGTGATATTGTGTCTTTTGATGCAACATACAGTACAAACAAGTATTCAATGGTTTTTGTACCTTTTACCAGTATTGACAATCATAGACGATGTGTGACTTTTGGGGCTGGATTACTATCTGACGAGAC...

Protein

Download Protein FASTA

166 aa · TkA03G381240|TK1151|PROTEIN

MLISRMEDRVKYVPNFFFDHKIENGYLTGVFWADEASRSNYKEFGDIVSFDATYSTNKYSMVFVPFTSIDNHRRCVTFGAGLLSDETTESFVWLLQTFLKAFGTQPKMIVTDQDAAMKIAISTVLTESRHRLCMWHINRKLPIKTPHEVFSHQSLRRIFTKLYGIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G381240`
TK1151 ID	TkA03G381240
OH-1004 ID	LXL04_022772
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.200
Protein coverage (%)	TK1151 97.590 / OH-1004 24.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G381240

Location Chr03:94027953-94029499 (-)

Description Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38180`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At1g76320`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At4g15090`	Transcription activator that recognizes and binds to the DNA consensus sequence 5'-CACGCGC-3'.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022772 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010018 far-red light signaling pathway Biological Process

GO:0010218 response to far red light Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G27110

ath:AT4G15090

ath:AT4G38180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.498

Rank 1 · TkA03G381240 · TK1151

Nucleus0.331

Rank 2 · TkA03G381240 · TK1151

Extracellular0.115

Rank 3 · TkA03G381240 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA03G381240 · TK1151

Cell membrane0.048

Rank 5 · TkA03G381240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21056ZSWIM1-3_RNaseH-like16-127 aa

PF16147DUF485520-72 aa

PF10551MULE47-139 aa

PF00665rve48-120 aa

PF00872Transposase_mut84-160 aa

PF13610DDE_Tnp_IS24090-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G381240	`PF21056`	ZSWIM1-3_RNaseH-like	16	127	1.3e-09	38.8
TkA03G381240	`PF16147`	DUF4855	20	72	0.19	11.6
TkA03G381240	`PF10551`	MULE	47	139	1.2e-27	96.9
TkA03G381240	`PF00665`	rve	48	120	0.012	16.5
TkA03G381240	`PF00872`	Transposase_mut	84	160	0.0081	15.8
TkA03G381240	`PF13610`	DDE_Tnp_IS240	90	140	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZL8`	Arabidopsis thaliana	sp\|Q9SZL8\|FRS5_ARATH Protein FAR1-RELATED SEQUENCE 5	39.000%	Swiss-Prot	Medium
`Q6NQJ7`	Arabidopsis thaliana	sp\|Q6NQJ7\|FRS4_ARATH Protein FAR1-RELATED SEQUENCE 4	38.600%	Swiss-Prot	Medium
`Q9SWG3`	Arabidopsis thaliana	sp\|Q9SWG3\|FAR1_ARATH Protein FAR-RED IMPAIRED RESPONSE 1	36.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card