TkA03G373460 | RubberDandelionOmics

Gene overview

TkA03G373460

Reference: TK1151 Chr: Chr03 Coordinates: 92174352-92174687 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkA03G373460|TK1151|cDNA

CAGTGTATTCCCGCAGTTTTGAAGGCTTTTGGTCCGGATGGAAATGAACAACTTGATGCAGAAGCTTGTGAGCAATTACAAATACTAGAAAATGAACTCAAAGTCAAAGGTACCAAGTTCTTTGGAGGTGACAACATTAACCTAGTGGATATTGCTGGTTGTGCCATGGCATATTGGGTTGGAATATTCCAAGATGCAACCGAAAAAGAGTTGATCACGAAAGAAAAGTTTCCAAAATTAACAGTTTGGGCTGATCAATC...

CDS

Download CDS FASTA

336 bp · TkA03G373460|TK1151|CDS

CAGTGTATTCCCGCAGTTTTGAAGGCTTTTGGTCCGGATGGAAATGAACAACTTGATGCAGAAGCTTGTGAGCAATTACAAATACTAGAAAATGAACTCAAAGTCAAAGGTACCAAGTTCTTTGGAGGTGACAACATTAACCTAGTGGATATTGCTGGTTGTGCCATGGCATATTGGGTTGGAATATTCCAAGATGCAACCGAAAAAGAGTTGATCACGAAAGAAAAGTTTCCAAAATTAACAGTTTGGGCTGATCAATC...

Protein

Download Protein FASTA

111 aa · TkA03G373460|TK1151|PROTEIN

QCIPAVLKAFGPDGNEQLDAEACEQLQILENELKVKGTKFFGGDNINLVDIAGCAMAYWVGIFQDATEKELITKEKFPKLTVWADQSFCSLIQHELCKTQLTLLCVLSSNI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G373460`
TK1151 ID	TkA03G373460
OH-1004 ID	LXL04_018511
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.800
Protein coverage (%)	TK1151 76.577 / OH-1004 39.171 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G373460`
Location	Chr03:92174352-92174687 (+)
Description	Similar to HSP26-A: Probable glutathione S-transferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018511` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006749 glutathione metabolic process Biological Process GO:0009407 toxin catabolic process Biological Process GO:0009408 response to heat Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009735 response to cytokinin Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009739 response to gibberellin Biological Process GO:0010038 response to metal ion Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004364 glutathione transferase activity Molecular Function
KEGG gene cross-reference	ath:AT3G09270 gmx:100527851 nta:107765700 nta:107800866 nta:107802704 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.694

Rank 1 · TkA03G373460 · TK1151

Nucleus0.203

Rank 2 · TkA03G373460 · TK1151

Endoplasmic reticulum0.082

Rank 3 · TkA03G373460 · TK1151

Mitochondrion0.079

Rank 4 · TkA03G373460 · TK1151

Peroxisome0.073

Rank 5 · TkA03G373460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00043GST_C18-85 aa

PF22041GST_C_720-66 aa

PF25907DUF796224-85 aa

PF14497GST_C_324-83 aa

PF13410GST_C_225-84 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G373460	`PF00043`	GST_C	18	85	2.2e-08	34.9
TkA03G373460	`PF22041`	GST_C_7	20	66	0.087	13.5
TkA03G373460	`PF25907`	DUF7962	24	85	3.8e-05	24.5
TkA03G373460	`PF14497`	GST_C_3	24	83	0.04	14.8
TkA03G373460	`PF13410`	GST_C_2	25	84	0.011	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card