TkA03G372060 | RubberDandelionOmics

Gene overview

TkA03G372060

Reference: TK1151 Chr: Chr03 Coordinates: 91787792-91789115 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1232 bp · TkA03G372060|TK1151|cDNA

ATTTACACTTAGCCCCCCTCCTTCTTCACTCCTCAAATACCGCCCACCACCAACACACCTTTCACCTTTCTCCGTTTCTCTCCAATAATCACAAGTTGCATTCATGGGAAGTTACTTCGGCGCCGGAGAATGCTTCTTTGAGCACCAGAAGCCGGTCGAATTCATCAACGGAGGCAATCAGTTCACCATTGATGACTTGCTCCTTGACTTTCCTAACGACGAAGATGTCGTCATGAACGAGGCCTTTTACGAGAGTTTTA...

CDS

Download CDS FASTA

942 bp · TkA03G372060|TK1151|CDS

ATGGGAAGTTACTTCGGCGCCGGAGAATGCTTCTTTGAGCACCAGAAGCCGGTCGAATTCATCAACGGAGGCAATCAGTTCACCATTGATGACTTGCTCCTTGACTTTCCTAACGACGAAGATGTCGTCATGAACGAGGCCTTTTACGAGAGTTTTAATAATTCTAATTCAGCTGATTTTTCCAGCTCAAATTCCTCTGTCTCCGGCAGCGAAGCTCAGTTATCCGGCAATATCAGCTCCTATAGCCTCTCTGACTCTCA...

Protein

Download Protein FASTA

313 aa · TkA03G372060|TK1151|PROTEIN

MGSYFGAGECFFEHQKPVEFINGGNQFTIDDLLLDFPNDEDVVMNEAFYESFNNSNSADFSSSNSSVSGSEAQLSGNISSYSLSDSQFSGDELCLPYDELAELEWLSSFTEESLSSDDLHNLQLISAANKAPATDTSSSDTTPEFQHKTTGPNRINSPIFQTNVLVPGKVRSKRSRAAPCDWSSRLLLLKSSTTDINKPNSSDNSVRRCLHCGSDKTPQWRRGPMGPKTLCNACGVRFKSGRLVPEYRPAASPSFVPAKH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G372060`
TK1151 ID	TkA03G372060
OH-1004 ID	LXL04_032144
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.400
Protein coverage (%)	TK1151 100.000 / OH-1004 97.273 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G372060

Location Chr03:91787792-91789115 (-)

Description Similar to GATA9: GATA transcription factor 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25830`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At4g32890`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At2g45050`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At3g60530`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At1g08010`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032144 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071555 cell wall organization Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G45050

ath:AT3G60530

ath:AT4G32890

ath:AT5G25830

ath:AT5G66320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA03G372060 · TK1151

Cytoplasm0.118

Rank 2 · TkA03G372060 · TK1151

Cell membrane0.036

Rank 3 · TkA03G372060 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkA03G372060 · TK1151

Plastid0.016

Rank 5 · TkA03G372060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24444DUF7563207-222 aa

PF00320GATA209-243 aa

PF24444DUF7563231-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G372060	`PF24444`	DUF7563	207	222	2.3	8.5
TkA03G372060	`PF00320`	GATA	209	243	3.8e-16	59.1
TkA03G372060	`PF24444`	DUF7563	231	235	2.3	8.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P69781`	Arabidopsis thaliana	sp\|P69781\|GAT12_ARATH GATA transcription factor 12	49.800%	Swiss-Prot	Medium
`O82632`	Arabidopsis thaliana	sp\|O82632\|GATA9_ARATH GATA transcription factor 9	41.500%	Swiss-Prot	Medium
`O49741`	Arabidopsis thaliana	sp\|O49741\|GATA2_ARATH GATA transcription factor 2	42.300%	Swiss-Prot	Medium
`O49743`	Arabidopsis thaliana	sp\|O49743\|GATA4_ARATH GATA transcription factor 4	43.700%	Swiss-Prot	Medium
`Q6DBP8`	Arabidopsis thaliana	sp\|Q6DBP8\|GAT11_ARATH GATA transcription factor 11	60.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card