TkA03G368770 | RubberDandelionOmics

Gene overview

TkA03G368770

Reference: TK1151 Chr: Chr03 Coordinates: 90964334-90965422 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · TkA03G368770|TK1151|cDNA

ATATAGAACGTGAAAAAGCTGCACGTTTGGAGGTAGAAAAAAAGCCCCGCATGCCCATATCCAAGACCAAATCTATCTCCGAGAATGGTTTGACTCGCAGACTTTCAAGTGCCAGCAGTTTAAGTAGTATGGAGGAGAGTTTCTATCTGCAGACGTCTTTAGACTCCACTAATACTTTCTCCCCCAAAGTGCATTCCGTACCTCCCTTTTATTTTAAAAACATCACCACCCCAAACGCTTTTCAAGCTGCTTTACGCCAA...

CDS

Download CDS FASTA

528 bp · TkA03G368770|TK1151|CDS

ATGCCCATATCCAAGACCAAATCTATCTCCGAGAATGGTTTGACTCGCAGACTTTCAAGTGCCAGCAGTTTAAGTAGTATGGAGGAGAGTTTCTATCTGCAGACGTCTTTAGACTCCACTAATACTTTCTCCCCCAAAGTGCATTCCGTACCTCCCTTTTATTTTAAAAACATCACCACCCCAAACGCTTTTCAAGCTGCTTTACGCCAAAAGGAGGGCGAACTTCAATCCTACATCTCTAGATTGGCATCAATGGAATC...

Protein

Download Protein FASTA

175 aa · TkA03G368770|TK1151|PROTEIN

MPISKTKSISENGLTRRLSSASSLSSMEESFYLQTSLDSTNTFSPKVHSVPPFYFKNITTPNAFQAALRQKEGELQSYISRLASMESIRESLSEELVKMTKECEKLRSEVGLLPSIKAELEALRIRHSAALELMGERDEELEELRADIVDVKEMYREQVNMLVNKIQKGESNPFA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G368770`
TK1151 ID	TkA03G368770
OH-1004 ID	LXL04_008469
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 32.288 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G368770

Location Chr03:90964334-90965422 (+)

Description Similar to GC5: Golgin candidate 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79830`	Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008469 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001675 acrosome assembly Biological Process

GO:0001819 positive regulation of cytokine production Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0007286 spermatid development Biological Process

GO:0007289 spermatid nucleus differentiation Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0030317 flagellated sperm motility Biological Process

GO:0030521 androgen receptor signaling pathway Biological Process

GO:0032275 luteinizing hormone secretion Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0061136 regulation of proteasomal protein catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G79830

hsa:7110

mmu:232286

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.690

Rank 1 · TkA03G368770 · TK1151

Nucleus0.210

Rank 2 · TkA03G368770 · TK1151

Golgi apparatus0.188

Rank 3 · TkA03G368770 · TK1151

Cell membrane0.090

Rank 4 · TkA03G368770 · TK1151

Lysosome / Vacuole0.080

Rank 5 · TkA03G368770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05667CCDC22_CC16-152 aa

PF12325TMF_TATA_bd57-162 aa

PF26095CC_Bre161-124 aa

PF24319DUF749162-127 aa

PF29997SPC25_N62-155 aa

PF13863DUF420063-110 aa

PF25764KIF21A_4th65-168 aa

PF08614ATG1665-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G368770	`PF05667`	CCDC22_CC	16	152	0.0024	17.8
TkA03G368770	`PF12325`	TMF_TATA_bd	57	162	1.5e-28	99.9
TkA03G368770	`PF26095`	CC_Bre1	61	124	0.019	16.0
TkA03G368770	`PF24319`	DUF7491	62	127	0.058	14.3
TkA03G368770	`PF29997`	SPC25_N	62	155	0.28	12.2
TkA03G368770	`PF13863`	DUF4200	63	110	3.2	8.8
TkA03G368770	`PF25764`	KIF21A_4th	65	168	0.055	13.9
TkA03G368770	`PF08614`	ATG16	65	153	0.18	12.7
TkA03G368770	`PF25366`	RUFY4	65	105	0.33	12.0
TkA03G368770	`PF21408`	MTR4-like_stalk	65	110	4.7	8.2
TkA03G368770	`PF20570`	DUF6779	65	124	8.3	7.8
TkA03G368770	`PF15905`	HMMR_N	68	171	0.0069	16.6
TkA03G368770	`PF24582`	DUF7609	71	102	0.19	12.7
TkA03G368770	`PF17675`	APG6_N	71	156	2.4	9.3
TkA03G368770	`PF00170`	bZIP_1	77	110	4.0	8.3
TkA03G368770	`PF30083`	Augmin_dgt2_C	78	145	0.14	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WVL7`	Arabidopsis thaliana	sp\|Q0WVL7\|GOGC5_ARATH Golgin candidate 5	71.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card