TkA03G367750 | RubberDandelionOmics

Gene overview

TkA03G367750

Reference: TK1151 Chr: Chr03 Coordinates: 90701627-90702229 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · TkA03G367750|TK1151|cDNA

ATGCTGATCAGAAAAACCATACACAAAACAAAAAAAATTCTCACCAAATCCCTTCAAAAGTTCAAATCCTTCATCTTTGGAGGGTACAGAAAGCTAAAGAAAGCCCCTTCTTTGAAGCTTTTCAACAACTCAAAAATGCAACAACTCGACAATTTCTACAAAGAATTCTGTGAGCAATGGGATTCTGGAGACATCGAATCAAATAAAAGTGTGAATGGAGATTTGAACAACAACAACAACAACAACAAAACTACAAACAC...

CDS

Download CDS FASTA

573 bp · TkA03G367750|TK1151|CDS

ATGCTGATCAGAAAAACCATACACAAAACAAAAAAAATTCTCACCAAATCCCTTCAAAAGTTCAAATCCTTCATCTTTGGAGGGTACAGAAAGCTAAAGAAAGCCCCTTCTTTGAAGCTTTTCAACAACTCAAAAATGCAACAACTCGACAATTTCTACAAAGAATTCTGTGAGCAATGGGATTCTGGAGACATCGAATCAAATAAAAGTGTGAATGGAGATTTGAACAACAACAACAACAACAACAAAACTACAAACAC...

Protein

Download Protein FASTA

190 aa · TkA03G367750|TK1151|PROTEIN

MLIRKTIHKTKKILTKSLQKFKSFIFGGYRKLKKAPSLKLFNNSKMQQLDNFYKEFCEQWDSGDIESNKSVNGDLNNNNNNNKTTNTMQDQKSVVINIPEDKKGIGCSKSNRHDLEQKMKELEMMDMKDEEQVLDIEEVLHYYSLLTSPIYQDLVDKFFTDMYSDFYVPNPPIRSNSVNSSMRRLVPLNV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G367750`
TK1151 ID	TkA03G367750
OH-1004 ID	LXL04_008481
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 15.973 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G367750`
Location	Chr03:90701627-90702229 (-)
Description	Similar to ddx11: ATP-dependent DNA helicase DDX11
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008481` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006139 nucleobase-containing compound metabolic process Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006974 DNA damage response Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:0009303 rRNA transcription Biological Process GO:0031297 replication fork processing Biological Process GO:0032091 negative regulation of protein binding Biological Process GO:0034085 establishment of sister chromatid cohesion Biological Process GO:0035563 positive regulation of chromatin binding Biological Process
KEGG gene cross-reference	dre:492353 hsa:1663 nfi:NFIA_071590 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.430

Rank 1 · TkA03G367750 · TK1151

Nucleus0.361

Rank 2 · TkA03G367750 · TK1151

Cell membrane0.324

Rank 3 · TkA03G367750 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA03G367750 · TK1151

Plastid0.040

Rank 5 · TkA03G367750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29600PEPCK_PPi_N58-121 aa

PF04079SMC_ScpB111-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G367750	`PF29600`	PEPCK_PPi_N	58	121	0.06	13.3
TkA03G367750	`PF04079`	SMC_ScpB	111	161	0.038	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card