TkA03G367500 | RubberDandelionOmics

Gene overview

TkA03G367500

Reference: TK1151 Chr: Chr03 Coordinates: 90657490-90660265 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1649 bp · TkA03G367500|TK1151|cDNA

CTACGTCTTCATTCAATCATTCTCCCTCATTTTTGGTGTTTTTTTCCGTTATAAGCCACGTACAAATAAACAACAAAATTGCTTGGGTTGGGCGAATGGGCGGTGCTTTTGTTTCTTGTTTCTTGCTTTTCGAACGAAACATGCTTCTAAACTAATAATCCCCTATTCCTTCTTTCAATTACTTCAATAACATGAACTCTTAAATTACAGCTCCTTTCCATACTCTGTTTTCGTAAAGTAAAACAGAGTCAGGATTGCGT...

CDS

Download CDS FASTA

930 bp · TkA03G367500|TK1151|CDS

ATGGATTTCTGGCCGGAATTTCTTGCAAGCAGTTGGGGTAAGGAATTTGTGGCCGGCGGATTTGGGGGAACCGCTGGAATCATGGCGGGATACCCACTTGACAGTATCAGAGTCCGGCAACAGAGCTCCGGTTCCGGCTCTGCTCTTCGCATTCTCCGGCATGTCGCATCTACTGAAGGTCCTCTTGCCCTGTACAGAGGCATGGCTGCTCCGCTTGCCTCTGTCACCTTCCAGAACGCTATGGTTTTCCAAATCTACGC...

Protein

Download Protein FASTA

309 aa · TkA03G367500|TK1151|PROTEIN

MDFWPEFLASSWGKEFVAGGFGGTAGIMAGYPLDSIRVRQQSSGSGSALRILRHVASTEGPLALYRGMAAPLASVTFQNAMVFQIYAILSRAFDTSVSSTEPPSYKGVALGGIGAGAIQSIMLSPIELIKIRLQLQTQSEKGPLTVAKNILKTEGYRGLYRGLTITALRDAPSHGFYFWTYEFMREKLHPGCRKRGQESFDTMLVAGGLAGVASWVCCYPLDVVKTRLQAQTPNSKVKYNGIVDCFRKSVRNDGYGVLFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G367500`
TK1151 ID	TkA03G367500
OH-1004 ID	LXL04_008484
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G367500

Location Chr03:90657490-90660265 (+)

Description Similar to BAC2: Mitochondrial arginine transporter BAC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79900`	Mitochondrial arginine transporter that catalyzes the counter-exchange of arginine with lysine, ornithine, arginine, histidine and citrulline.	Arabidopsis mitochondria have two basic amino acid transporters with partially overlapping specificities and differential expression in seedling development.2006 · DOI: 10.1016/j.bbabio.2006.03.025 Mutations in the hyperosmotic stress-responsive mitochondrial BASIC AMINO ACID CARRIER2 enhance proline accumulation in Arabidopsis.2010 · DOI: 10.1104/pp.109.152371

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008484 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006972 hyperosmotic response Biological Process

GO:0045329 carnitine biosynthetic process Biological Process

GO:0055129 L-proline biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0000064 L-ornithine transmembrane transporter activity Molecular Function

GO:0005290 L-histidine transmembrane transporter activity Molecular Function

GO:0015189 L-lysine transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0061459 L-arginine transmembrane transporter activity Molecular Function

GO:7770026 N(6),N(6),N(6)-trimethyl-L-lysine transmembrane transporter activity Molecular Function

GO:7770027 dimethylarginine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G79900

hsa:283130

mmu:107375

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.867

Rank 1 · TkA03G367500 · TK1151

Cytoplasm0.032

Rank 2 · TkA03G367500 · TK1151

Plastid0.030

Rank 3 · TkA03G367500 · TK1151

Nucleus0.024

Rank 4 · TkA03G367500 · TK1151

Cell membrane0.016

Rank 5 · TkA03G367500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr11-93 aa

PF00153Mito_carr109-188 aa

PF00153Mito_carr201-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G367500	`PF00153`	Mito_carr	11	93	2.1e-66	220.4
TkA03G367500	`PF00153`	Mito_carr	109	188	2.1e-66	220.4
TkA03G367500	`PF00153`	Mito_carr	201	289	2.1e-66	220.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA93`	Arabidopsis thaliana	sp\|Q9CA93\|BAC2_ARATH Mitochondrial arginine transporter BAC2	71.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card