TkA03G363390 | RubberDandelionOmics

Gene overview

TkA03G363390

Reference: TK1151 Chr: Chr03 Coordinates: 89639108-89643035 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1723 bp · TkA03G363390|TK1151|cDNA

CTCAAATGTTCGAGTTTGAACTCTACGTTCGTCCCGCTCTCTGATTATTTAATCTCCAGCTGTCCCTCTTTCCGAAATTCTTCATGTTTCTAAGCTATCAATTCTATTGAGCTGATTCACTAGCTCCGTAACACGATCTAATCATCTATATAGAGGGAAACCATTTCAAATTAAAACCTTGAATTTGGTTTTCTTCAAAAAAAAAACATACAAATGAGAAAAGGAGCTAATGTTGTGGAGCCCACTTTTCGTGTAACACG...

CDS

Download CDS FASTA

1338 bp · TkA03G363390|TK1151|CDS

ATGAGAAAAGGAGCTAATGTTGTGGAGCCCACTTTTCGTGTAACACGAGCTCGTGCTGCTGCTTGCAAGAATTCAGAAGCACCAAAAGACCAGGGGCAAGATCGTCCTTTGCGTAAAAATCCTAAAAGATCCGTGCAAGTTGACACAAACAACACTACTAACAAGAGGAGAGCAGTTCTTAAAGATGTCACAAACATTTGTTGTGATAATTCCTACAAAAACTGCATAATTCCAGCCAAAATTCCGAAAAAGACTAGCAA...

Protein

Download Protein FASTA

445 aa · TkA03G363390|TK1151|PROTEIN

MRKGANVVEPTFRVTRARAAACKNSEAPKDQGQDRPLRKNPKRSVQVDTNNTTNKRRAVLKDVTNICCDNSYKNCIIPAKIPKKTSKISKKNPIKPDHVSAQTQTIAVDHIVDLDKTVIHQKSIQPVEKESADQIGKRVGSQFQKFSKKGRNNIPEKTMEASNKVDFKDIDTDEKDPQMCSFYALEIYNNLRASELVRRPHSDFMEKVQRDVTQSMRGVLVDWLVEVSEEYKLVADTLYLTVYLIDLFLSQHYIERQKLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G363390`
TK1151 ID	TkA03G363390
OH-1004 ID	LXL04_008519
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G363390

Location Chr03:89639108-89643035 (+)

Description Similar to CYCA2-1: Cyclin-A2-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80370`	Cyclin-A2-4.	No verified direct reference in this release
`At1g15570`	Negatively regulates endocycles and acts as a regulator of ploidy levels in endoreduplication.	No verified direct reference in this release
`At5g25380`	May negatively regulate endocycles and act as a regulator of ploidy levels in endoreduplication.	No verified direct reference in this release
`At5g11300`	Cyclin-A2-2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0502300`	Cyclin-A2-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008519 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010374 stomatal complex development Biological Process

GO:0010389 regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0010444 guard mother cell differentiation Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0044839 cell cycle G2/M phase transition Biological Process

GO:0051301 cell division Biological Process

GO:2000123 positive regulation of stomatal complex development Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G15570

ath:AT1G80370

ath:AT5G11300

ath:AT5G25380

dosa:Os12g0502300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.784

Rank 1 · TkA03G363390 · TK1151

Cytoplasm0.262

Rank 2 · TkA03G363390 · TK1151

Mitochondrion0.052

Rank 3 · TkA03G363390 · TK1151

Cell membrane0.025

Rank 4 · TkA03G363390 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA03G363390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03566Peptidase_A2121-58 aa

PF00134Cyclin_N186-311 aa

PF02984Cyclin_C236-272 aa

PF02984Cyclin_C315-437 aa

PF00134Cyclin_N363-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G363390	`PF03566`	Peptidase_A21	21	58	0.42	9.6
TkA03G363390	`PF00134`	Cyclin_N	186	311	6.5e-44	149.4
TkA03G363390	`PF02984`	Cyclin_C	236	272	4.5e-36	124.2
TkA03G363390	`PF02984`	Cyclin_C	315	437	4.5e-36	124.2
TkA03G363390	`PF00134`	Cyclin_N	363	391	6.5e-44	149.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C968`	Arabidopsis thaliana	sp\|Q9C968\|CCA24_ARATH Cyclin-A2-4	52.200%	Swiss-Prot	High
`Q38819`	Arabidopsis thaliana	sp\|Q38819\|CCA23_ARATH Cyclin-A2-3	69.500%	Swiss-Prot	Medium
`Q39071`	Arabidopsis thaliana	sp\|Q39071\|CCA21_ARATH Cyclin-A2-1	50.800%	Swiss-Prot	High
`Q147G5`	Arabidopsis thaliana	sp\|Q147G5\|CCA22_ARATH Cyclin-A2-2	51.400%	Swiss-Prot	High
`Q2QQ96`	Oryza sativa subsp. japonica	sp\|Q2QQ96\|CCA21_ORYSJ Cyclin-A2-1	56.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card