RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G362500
Reference: TK1151 Chr: Chr03 Coordinates: 89370136-89372023 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1494 bp · TkA03G362500|TK1151|cDNA

ATGTACGTGAAATGCGGGGATGTGTATAGTGCTCGCATAGTGTTCGATAAAATGCCTGTAAAGGACACCATATCATGGAACGCAATGATTTCAGGATATTTCGAAAACTACAAGTGTCTAGAAGGCCTAAATCTCTTTCTTGAAATGCTTAATCGCTTCATAGTCCCAGATTTGATGACTATCACTAGTGTAATCTCAGCGTGTGAACTTTACTCAAGTCTTGGATCTTGGGAACAAGCAGAAAAGATTTTCACACGAAT...

CDS

Download CDS FASTA

1494 bp · TkA03G362500|TK1151|CDS

ATGTACGTGAAATGCGGGGATGTGTATAGTGCTCGCATAGTGTTCGATAAAATGCCTGTAAAGGACACCATATCATGGAACGCAATGATTTCAGGATATTTCGAAAACTACAAGTGTCTAGAAGGCCTAAATCTCTTTCTTGAAATGCTTAATCGCTTCATAGTCCCAGATTTGATGACTATCACTAGTGTAATCTCAGCGTGTGAACTTTACTCAAGTCTTGGATCTTGGGAACAAGCAGAAAAGATTTTCACACGAAT...

Protein

Download Protein FASTA

497 aa · TkA03G362500|TK1151|PROTEIN

MYVKCGDVYSARIVFDKMPVKDTISWNAMISGYFENYKCLEGLNLFLEMLNRFIVPDLMTITSVISACELYSSLGSWEQAEKIFTRITSKDVVSWTSMISGYENNQQPEKAVQVYKNMRKDNIAPDEITLASVISACGNIGALMAGKEVHGYTLRTGLAFTGSKYLPNAILDMYTKCGKMDTSWNQFNSQYKDITSWNTLLTGYAKRGEGEKAVNLFKMVKESVKPDGVTFISLLCACSRSGMVEKGLKYYNIMTQNYNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G362500
TK1151 IDTkA03G362500
OH-1004 IDLXL04_008532
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)77.600
Protein coverage (%)TK1151 100.000 / OH-1004 74.733
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G362500
LocationChr03:89370136-89372023 (+)
DescriptionSimilar to PCMP-H73: Pentatricopeptide repeat-containing protein At1g15510, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g15510 Regulates the RNA editing of the chloroplast transcript accD, and is essential for the early stages of chloroplast biogenesis.
AtECB2, a pentatricopeptide repeat protein, is required for chloroplast transcript accD RNA editing and early chloroplast biogenesis in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03930.x
Editing of accD and ndhF chloroplast transcripts is partially affected in the Arabidopsis vanilla cream1 mutant.2010 · DOI: 10.1007/s11103-010-9616-5
A point mutation in the pentatricopeptide repeat motif of the AtECB2 protein causes delayed chloroplast development.2011 · DOI: 10.1111/j.1744-7909.2011.01030.x
At4g18750 Plays a major role in single RNA editing events in chloroplasts.
Identification of two pentatricopeptide repeat genes required for RNA editing and zinc binding by C-terminal cytidine deaminase-like domains.2013 · DOI: 10.1074/jbc.m113.485755
At3g23330 Putative pentatricopeptide repeat-containing protein At3g23330. No verified direct reference in this release
At3g49142 Putative pentatricopeptide repeat-containing protein At3g49142. No verified direct reference in this release
At4g33990 Pentatricopeptide repeat-containing protein At4g33990. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008532 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006397 mRNA processing Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009451 RNA modification Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0010588 cotyledon vascular tissue pattern formation Biological Process
GO:0048366 leaf development Biological Process
GO:1900865 chloroplast RNA modification Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference
ath:AT1G15510
ath:AT4G18750
ath:AT4G33990
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.574
Rank 1 · TkA03G362500 · TK1151
Plastid0.267
Rank 2 · TkA03G362500 · TK1151
Nucleus0.058
Rank 3 · TkA03G362500 · TK1151
Cytoplasm0.042
Rank 4 · TkA03G362500 · TK1151
Peroxisome0.008
Rank 5 · TkA03G362500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_22-19 aa
PF01535PPR2-19 aa
PF12854PPR_14-18 aa
PF14432DYW_deaminase5-39 aa
PF22330Rib_mS39_PPR11-35 aa
PF13041PPR_221-68 aa
PF12854PPR_122-35 aa
PF01535PPR24-51 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G362500PF13041PPR_22195.9e-45151.9
TkA03G362500PF01535PPR2191.6e-37125.8
TkA03G362500PF12854PPR_14181.1e-1557.7
TkA03G362500PF14432DYW_deaminase5395.8e-29100.5
TkA03G362500PF22330Rib_mS39_PPR11350.07513.5
TkA03G362500PF13041PPR_221685.9e-45151.9
TkA03G362500PF12854PPR_122351.1e-1557.7
TkA03G362500PF01535PPR24511.6e-37125.8
TkA03G362500PF13812PPR_325681.4e-1661.1
TkA03G362500PF23276TPR_24261173.9e-0834.0
TkA03G362500PF29070MSC6_N261171.7e-0524.9
TkA03G362500PF17177PPR_long411421.5e-0628.5
TkA03G362500PF13812PPR_345861.4e-1661.1
TkA03G362500PF12854PPR_154671.1e-1557.7
TkA03G362500PF20431E_motif69854.6e-1349.9
TkA03G362500PF13176TPR_769904.3e-0524.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M9E2Arabidopsis thalianasp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protein At1g15510, chloroplastic48.900%Swiss-ProtMedium
Q9SN39Arabidopsis thalianasp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein DOT4, chloroplastic37.200%Swiss-ProtMedium
Q9LW63Arabidopsis thalianasp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing protein At3g2333036.800%Swiss-ProtMedium
P0C899Arabidopsis thalianasp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containing protein At3g4914239.100%Swiss-ProtMedium
O81767Arabidopsis thalianasp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein At4g3399038.600%Swiss-ProtMedium

JBrowse

View in Genome Browser