Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1822 bp · TkA03G362430|TK1151|cDNA
TTACAACCTTCAACTGTCACATAATTGTCATACATATTAGTTATATCTATTTGGTCATCAGTTGCCTTGTTATTTTTTACAAACGGTATTGAAAACAAGATACCGAGGGGTTTATAGTGGTCTCGAAAACTTGAGCACCAATAATTGTTACTTATCTATCTACGGGGAAAATCTGTCACCCGAAAATATGGATGAAGAATCGCCAACTACCACAGTCCCACTCCTCCGCGACCGCCGCCAGTGGTGGCGCCAAATCCCAT...
738 bp · TkA03G362430|TK1151|CDS
ATGAAAACACCGACCCCGTTCCCGGAAATCGTCGAGTCCGTCGGAGGCTTCAGATTCTTTCATCCATCCTGCTGCCCTAATCGTATTTCTTATCGGAATAATCTTATGTTTCATTATAGACCCTACAATCTTCAACGATCTACAATTAGGTCCATCGAAGTTTCACGTCTTGAAAATCACCTGGGACGACATGAAAACCGGATTTCTCCGAGGATCGGTGCCTCAAATCCCGCTCTCCGTTCTAAACTCCGTAATCGCAG...
Protein
Download Protein FASTA245 aa · TkA03G362430|TK1151|PROTEIN
MKTPTPFPEIVESVGGFRFFHPSCCPNRISYRNNLMFHYRPYNLQRSTIRSIEVSRLENHLGRHENRISPRIGASNPALRSKLRNRSFCKLSNDLFPDHEASVTAVSMSVGVMNLVGCWFGAMPVCHGAGGLAGQYRFGGRTGASVVLLGAGKLVLGLLFGNSFVRILNQFPVGILGALLLFAGIELAMASKDMNTKEESFVMLVCAAVSLTGSSAALGFVCGIVLFVVLKLREVDCGGSDDVDE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G362430 |
|---|---|
| TK1151 ID | TkA03G362430 |
| OH-1004 ID | LXL04_008534 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 64.082 / OH-1004 34.812Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G362430 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:89348328-89351224 (+) | |||||||||
| Description | Similar to MOT2: Molybdate transporter 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0015689 molybdate ion transport Biological Process GO:0090414 molybdate ion export from vacuole Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005774 vacuolar membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009705 plant-type vacuole membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0015098 molybdate ion transmembrane transporter activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G80310 ath:AT2G25680 cre:CHLRE_04g214050v5 ncr:NCU01356 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16983MFS_MOT189-187 aaPF06699PIG-F108-125 aaPF00916Sulfate_transp109-198 aaPF230216TM_2nd_PGAP2IP117-117 aaPF230216TM_2nd_PGAP2IP169-230 aaPF06699PIG-F178-227 aaPF16983MFS_MOT1216-223 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G362430 | PF16983 | MFS_MOT1 | 89 | 187 | 5.3e-30 | 104.9 |
| TkA03G362430 | PF06699 | PIG-F | 108 | 125 | 0.16 | 12.9 |
| TkA03G362430 | PF00916 | Sulfate_transp | 109 | 198 | 0.00071 | 19.2 |
| TkA03G362430 | PF23021 | 6TM_2nd_PGAP2IP | 117 | 117 | 0.025 | 15.1 |
| TkA03G362430 | PF23021 | 6TM_2nd_PGAP2IP | 169 | 230 | 0.025 | 15.1 |
| TkA03G362430 | PF06699 | PIG-F | 178 | 227 | 0.16 | 12.9 |
| TkA03G362430 | PF16983 | MFS_MOT1 | 216 | 223 | 5.3e-30 | 104.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.