TkA03G361430 | RubberDandelionOmics

Gene overview

TkA03G361430

Reference: TK1151 Chr: Chr03 Coordinates: 89160489-89171349 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1881 bp · TkA03G361430|TK1151|cDNA

ATGGCCGAAATGGGTTTTGGTTTCAAATGGAGGAGGTGGATCGAAGGGTGTCTGGCTAATGCGCGTGCTTCTGTCCTTGTTAATGGAGTGCCTACTAATGAGTTCGAGGTGTTTAGAGGCCTTAGACAAGGAGATCCCCTGTCCCCCTTCTTATTTATTCTGGCCATGGAGGGATTACATGCTATTGTTCAAAAGGCAAAGAGTGTTAACTTGGTTGCTGGTGTACAGGTTGGAGGTCATGGTGTGCCTGTTTCTCATCT...

CDS

Download CDS FASTA

1881 bp · TkA03G361430|TK1151|CDS

ATGGCCGAAATGGGTTTTGGTTTCAAATGGAGGAGGTGGATCGAAGGGTGTCTGGCTAATGCGCGTGCTTCTGTCCTTGTTAATGGAGTGCCTACTAATGAGTTCGAGGTGTTTAGAGGCCTTAGACAAGGAGATCCCCTGTCCCCCTTCTTATTTATTCTGGCCATGGAGGGATTACATGCTATTGTTCAAAAGGCAAAGAGTGTTAACTTGGTTGCTGGTGTACAGGTTGGAGGTCATGGTGTGCCTGTTTCTCATCT...

Protein

Download Protein FASTA

626 aa · TkA03G361430|TK1151|PROTEIN

MAEMGFGFKWRRWIEGCLANARASVLVNGVPTNEFEVFRGLRQGDPLSPFLFILAMEGLHAIVQKAKSVNLVAGVQVGGHGVPVSHLMYADDVIFVGDWSIQNASNLIGMLRCFYVMSGLKINVKKSNLIGVGVEVADTRVMAQVLGCGVAALPFKYLGVPVGSDMSRVGSWREVIEKIKVKLSNWRARFLSVGGRLTLIKAVLGNLPIYYLSIYKVPVAVEKQLEALRNFFIGGDLEERKMTWVAWRKCLASRELGGLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G361430`
TK1151 ID	TkA03G361430
OH-1004 ID	LXL04_015205
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	44.000
Protein coverage (%)	TK1151 93.131 / OH-1004 53.958 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G361430

Location Chr03:89160489-89171349 (+)

Description Similar to At1g61190: Probable disease resistance protein At1g61190

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92555`	Uncharacterized mitochondrial protein AtMg01250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015205 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G61180

ath:AT1G61190

ath:AT1G61300

ath:AT4G26090

ath:AT4G27220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.552

Rank 1 · TkA03G361430 · TK1151

Nucleus0.243

Rank 2 · TkA03G361430 · TK1151

Cell membrane0.190

Rank 3 · TkA03G361430 · TK1151

Golgi apparatus0.079

Rank 4 · TkA03G361430 · TK1151

Lysosome / Vacuole0.058

Rank 5 · TkA03G361430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_19-161 aa

PF13966zf-RVT242-253 aa

PF13966zf-RVT343-369 aa

PF13966zf-RVT430-515 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G361430	`PF00078`	RVT_1	9	161	1.1e-12	49.0
TkA03G361430	`PF13966`	zf-RVT	242	253	2.6e-19	70.3
TkA03G361430	`PF13966`	zf-RVT	343	369	2.6e-19	70.3
TkA03G361430	`PF13966`	zf-RVT	430	515	2.6e-19	70.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92555`	Arabidopsis thaliana	sp\|P92555\|M1250_ARATH Uncharacterized mitochondrial protein AtMg01250	41.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card